F282674

General Info

Members Datasets Scaffolds Average Seq Length
184 123 368 210

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10457742|Ga0207652_104577422
Length 220
Sequence MCWDFAASRRRSSIPQQFWRKPMQRGIKRVGDVAAAGVLLVIXXPXXVAIAAAIYLTRGGPVLFRQTRSGRHGVPFTLVKFRTMRDAFAADAGRLTPLGRCLRSSSLDELPQLWNVLTGEMSLVGPRPLLLKYLPLYDQFQRRRLETTPGITGWAQIHGRNAVDWEPRFRLDVWYVDHWSLGLDFRILGRTLLSVLGRQGITAAGHTSMPEFQGSAPENP

Samples

Sample ID Description Type Environment
1 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
47 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
48 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
67 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
88 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
96 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
100 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
101 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 0
Rhizoplane 2.72
Rhizosphere 92.39
Stem 0
Stem Tuber 0
Unclassified 4.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207652_10457742 3300025921 Unclassified 1150
2 Ga0055535_1007206 3300003761 Bacteria 2149
3 Ga0070658_10071443 3300005327 Bacteria 2843
4 Ga0070658_10656693 3300005327 Bacteria 910
5 Ga0070683_100378792 3300005329 Bacteria 1348
6 Ga0070680_100078883 3300005336 Bacteria 2713
7 Ga0070680_100080755 3300005336 Bacteria 2682
8 Ga0070660_100002571 3300005339 Bacteria 12445
9 Ga0070660_100047733 3300005339 Bacteria 3286
10 Ga0070660_100815409 3300005339 Bacteria 785
11 Ga0070661_100337688 3300005344 Bacteria 1180
12 Ga0070675_100067989 3300005354 Bacteria 2949
13 Ga0070659_100032949 3300005366 Bacteria 4023
14 Ga0070659_101006561 3300005366 Bacteria 732
15 Ga0070700_100123602 3300005441 Bacteria 1737
16 Ga0070662_100348159 3300005457 Bacteria 1213
17 Ga0070681_10000854 3300005458 Bacteria 25602
18 Ga0070681_10035674 3300005458 Bacteria 4994
19 Ga0070679_100017221 3300005530 Bacteria 6990
20 Ga0070679_100086464 3300005530 Bacteria 3122
21 Ga0070679_100419740 3300005530 Bacteria 1283
22 Ga0068853_100328198 3300005539 Bacteria 1419
23 Ga0068853_100410266 3300005539 Unclassified 1269
24 Ga0068853_100775399 3300005539 Bacteria 917
25 Ga0070672_100081931 3300005543 Bacteria 2588
26 Ga0068855_100183578 3300005563 Bacteria 2364
27 Ga0068855_100291464 3300005563 Bacteria 1809
28 Ga0068855_100743570 3300005563 Bacteria 1046
29 Ga0070664_100075416 3300005564 Bacteria 2896
30 Ga0068857_100003228 3300005577 Bacteria 13532
31 Ga0068857_100003722 3300005577 Bacteria 12801
32 Ga0068852_100009099 3300005616 Bacteria 7352
33 Ga0081539_10018345 3300005985 Bacteria 4860
34 Ga0075365_10044859 3300006038 Bacteria 2898
35 Ga0097621_100994643 3300006237 Bacteria 784
36 Ga0075428_100045543 3300006844 Bacteria 4819
37 Ga0075431_100165017 3300006847 Bacteria 2277
38 Ga0075433_10369860 3300006852 Bacteria 1266
39 Ga0075434_100018137 3300006871 Bacteria 6793
40 Ga0075434_100932827 3300006871 Bacteria 883
41 Ga0075429_100112165 3300006880 Bacteria 2383
42 Ga0097620_101176187 3300006931 Bacteria 844
43 Ga0075435_100002283 3300007076 Bacteria 12660
44 Ga0111539_10513322 3300009094 Bacteria 1396
45 Ga0114129_10000514 3300009147 Bacteria 47437
46 Ga0114129_10208604 3300009147 Bacteria 2642
47 Ga0105241_10109353 3300009174 Bacteria 2211
48 Ga0105241_10630474 3300009174 Bacteria 971
49 Ga0105242_10051532 3300009176 Unclassified 3354
50 Ga0105248_11075615 3300009177 Bacteria 909
51 Ga0105238_10027271 3300009551 Bacteria 5820
52 Ga0105249_10152271 3300009553 Bacteria 2227
53 Ga0157371_10000208 3300013102 Bacteria 85966
54 Ga0157371_10131420 3300013102 Bacteria 1781
55 Ga0157370_10028446 3300013104 Bacteria 5497
56 Ga0157370_10071755 3300013104 Bacteria 3267
57 Ga0157370_10137635 3300013104 Bacteria 2275
58 Ga0157369_10076646 3300013105 Bacteria 3584
59 Ga0157378_10751437 3300013297 Bacteria 998
60 Ga0163162_10315278 3300013306 Bacteria 1696
61 Ga0157372_10011096 3300013307 Bacteria 9584
62 Ga0157372_10060546 3300013307 Bacteria 4236
63 Ga0157372_10090432 3300013307 Bacteria 3480
64 Ga0157375_12111331 3300013308 Bacteria 670
65 Ga0163163_10007933 3300014325 Bacteria 9386
66 Ga0157380_10562294 3300014326 Bacteria 1121
67 Ga0209435_101225 3300025206 Bacteria 3441
68 Ga0209437_101341 3300025233 Bacteria 6427
69 Ga0209759_1010228 3300025256 Bacteria 2765
70 Ga0207705_10010747 3300025909 Bacteria 6645
71 Ga0207705_10753122 3300025909 Bacteria 757
72 Ga0207654_10079546 3300025911 Bacteria 1969
73 Ga0207707_10019953 3300025912 Bacteria 5850
74 Ga0207660_10122779 3300025917 Bacteria 1969
75 Ga0207660_10137895 3300025917 Bacteria 1863
76 Ga0207657_10003398 3300025919 Bacteria 17013
77 Ga0207657_10010812 3300025919 Bacteria 9081
78 Ga0207657_10186745 3300025919 Bacteria 1674
79 Ga0207657_10682432 3300025919 Bacteria 798
80 Ga0207700_10027414 3300025928 Bacteria 3989
81 Ga0207644_10390871 3300025931 Bacteria 1135
82 Ga0207690_10281046 3300025932 Bacteria 1296
83 Ga0207690_10582049 3300025932 Bacteria 912
84 Ga0207706_10385156 3300025933 Bacteria 1216
85 Ga0207686_10063866 3300025934 Unclassified 2343
86 Ga0207667_10048880 3300025949 Bacteria 4471
87 Ga0207667_10327235 3300025949 Bacteria 1565
88 Ga0207712_10142332 3300025961 Bacteria 1842
89 Ga0207640_10221684 3300025981 Bacteria 1448
90 Ga0207639_10158261 3300026041 Bacteria 1906
91 Ga0207639_10247896 3300026041 Unclassified 1552
92 Ga0207639_10506295 3300026041 Bacteria 1104
93 Ga0207639_11121433 3300026041 Bacteria 738
94 Ga0207674_10001696 3300026116 Bacteria 28241
95 Ga0207674_10003821 3300026116 Bacteria 18357
96 Ga0207698_10071286 3300026142 Bacteria 2757
97 Ga0207428_10060950 3300027907 Bacteria 2989
98 Ga0265339_10029976 3300031249 Bacteria 3083
99 Ga0316578_10034371 3300031728 Bacteria 2911
100 Ga0307413_10048725 3300031824 Bacteria 2534
101 Ga0307413_10054989 3300031824 Bacteria 2419
102 Ga0307413_10184180 3300031824 Bacteria 1492
103 Ga0307413_10201341 3300031824 Bacteria 1438
104 Ga0307410_10003366 3300031852 Bacteria 8010
105 Ga0307410_10050706 3300031852 Bacteria 2793
106 Ga0307410_10070897 3300031852 Bacteria 2415
107 Ga0307410_10296411 3300031852 Bacteria 1274
108 Ga0307410_10334051 3300031852 Bacteria 1206
109 Ga0307406_10057112 3300031901 Unclassified 2502
110 Ga0307406_10172761 3300031901 Bacteria 1566
111 Ga0307407_10005170 3300031903 Bacteria 5633
112 Ga0307412_10008862 3300031911 Bacteria 5761
113 Ga0307412_10075355 3300031911 Bacteria 2314
114 Ga0307409_100030202 3300031995 Bacteria 3891
115 Ga0307409_100051884 3300031995 Bacteria 3141
116 Ga0307409_100095822 3300031995 Bacteria 2446
117 Ga0307409_100415944 3300031995 Bacteria 1288
118 Ga0307409_100759326 3300031995 Bacteria 974
119 Ga0307409_100824839 3300031995 Bacteria 936
120 Ga0307416_100015695 3300032002 Bacteria 5240
121 Ga0307414_10013447 3300032004 Bacteria 4874
122 Ga0307414_10021774 3300032004 Bacteria 4032
123 Ga0307414_10022569 3300032004 Bacteria 3974
124 Ga0307414_10079344 3300032004 Bacteria 2396
125 Ga0307411_10000472 3300032005 Bacteria 13965
126 Ga0307411_10041214 3300032005 Bacteria 2935
127 Ga0307411_10076720 3300032005 Bacteria 2285
128 Ga0307411_10085589 3300032005 Bacteria 2184
129 Ga0307411_10598080 3300032005 Bacteria 948
130 Ga0307415_100716780 3300032126 Bacteria 904
131 Ga0373943_0101599 3300035170 Bacteria 1505
132 Ga0316574_0328540 3300035398 Bacteria 970
133 Ga0373937_0010257 3300036401 Bacteria 8177
134 Ga0373937_0171355 3300036401 Bacteria 2037
135 Ga0316584_0005274 3300036712 Bacteria 8654
136 Ga0373925_0051736 3300037068 Bacteria 3067
137 Ga0395900_0091303 3300037418 Unclassified 3130
138 Ga0395900_0212208 3300037418 Bacteria 1954
139 Ga0395898_0055241 3300037466 Bacteria 3873
140 Ga0395905_0033185 3300037471 Bacteria 4850
141 Ga0395901_0100617 3300038443 Bacteria 3032
142 Ga0400490_52709 3300038726 Bacteria 13761
143 Ga0400483_053815 3300039062 Bacteria 5051
144 Ga0400483_200369 3300039062 Bacteria 13060
145 Ga0466963_0080952 3300044694 Bacteria 2199
146 Ga0453684_0646074 3300044712 Bacteria 1155
147 Ga0466970_0093746 3300044765 Bacteria 1631
148 Ga0451576_0328119 3300045051 Bacteria 1602
149 Ga0466958_0118586 3300045836 Bacteria 1655
150 Ga0495630_0201507 3300046517 Bacteria 1519
151 Ga0495666_0039240 3300046526 Bacteria 2300
152 Ga0495587_0057213 3300046536 Bacteria 2293
153 Ga0495667_0105653 3300046559 Bacteria 1820
154 Ga0495674_0068890 3300047319 Bacteria 3061
155 Ga0495674_0682074 3300047319 Bacteria 808
156 Ga0495675_0076296 3300047444 Bacteria 2113
157 Ga0495675_0129203 3300047444 Bacteria 1571
158 Ga0495684_0059794 3300047471 Bacteria 2901
159 Ga0495602_0133589 3300048088 Bacteria 1975
160 Ga0496101_0366245 3300048904 Bacteria 1133
161 Ga0496102_0002158 3300048905 Bacteria 16890
162 Ga0496103_0084697 3300048906 Bacteria 1997
163 Ga0496107_0054592 3300048910 Bacteria 2884
164 Ga0496114_0007189 3300048917 Bacteria 8787
165 Ga0501039_0190260 3300049575 Bacteria 1614
166 Ga0501040_0226808 3300049576 Bacteria 1330
167 Ga0501046_0143528 3300049580 Bacteria 1805
168 Ga0501073_0009223 3300049589 Bacteria 7275
169 Ga0501073_0068744 3300049589 Bacteria 2468
170 nmdc:mga0k408_78_c1 3300050493 Bacteria 45819
171 nmdc:mga05p37_1584_c1 3300050507 Bacteria 26427
172 nmdc:mga05p37_180422_c1 3300050507 Bacteria 2569
173 nmdc:mga09592_360680_c1 3300050508 Bacteria 1258
174 nmdc:mga0qj67_583677_c1 3300050509 Bacteria 895
175 nmdc:mga06r32_153025_c1 3300050510 Bacteria 2286
176 nmdc:mga08y16_907041_c1 3300050511 Bacteria 867
177 nmdc:mga0n895_1086328_c1 3300050512 Bacteria 778
178 nmdc:mga0n895_86078_c1 3300050512 Unclassified 3139
179 nmdc:mga0rr50_2285_c1 3300050513 Bacteria 10746
180 nmdc:mga0a205_383653_c1 3300050515 Bacteria 1270
181 Ga0495619_0053987 3300053085 Bacteria 2659
182 Ga0501084_0002346 3300054114 Bacteria 15220
183 Ga0501082_0269484 3300060353 Bacteria 1482
184 Ga0530510_0026201 3300061734 Bacteria 4171
185 Ga0207652_10457742
186 Ga0055535_1007206
187 Ga0070658_10071443
188 Ga0070658_10656693
189 Ga0070683_100378792
190 Ga0070680_100078883
191 Ga0070680_100080755
192 Ga0070660_100002571
193 Ga0070660_100047733
194 Ga0070660_100815409
195 Ga0070661_100337688
196 Ga0070675_100067989
197 Ga0070659_100032949
198 Ga0070659_101006561
199 Ga0070700_100123602
200 Ga0070662_100348159
201 Ga0070681_10000854
202 Ga0070681_10035674
203 Ga0070679_100017221
204 Ga0070679_100086464
205 Ga0070679_100419740
206 Ga0068853_100328198
207 Ga0068853_100410266
208 Ga0068853_100775399
209 Ga0070672_100081931
210 Ga0068855_100183578
211 Ga0068855_100291464
212 Ga0068855_100743570
213 Ga0070664_100075416
214 Ga0068857_100003228
215 Ga0068857_100003722
216 Ga0068852_100009099
217 Ga0081539_10018345
218 Ga0075365_10044859
219 Ga0097621_100994643
220 Ga0075428_100045543
221 Ga0075431_100165017
222 Ga0075433_10369860
223 Ga0075434_100018137
224 Ga0075434_100932827
225 Ga0075429_100112165
226 Ga0097620_101176187
227 Ga0075435_100002283
228 Ga0111539_10513322
229 Ga0114129_10000514
230 Ga0114129_10208604
231 Ga0105241_10109353
232 Ga0105241_10630474
233 Ga0105242_10051532
234 Ga0105248_11075615
235 Ga0105238_10027271
236 Ga0105249_10152271
237 Ga0157371_10000208
238 Ga0157371_10131420
239 Ga0157370_10028446
240 Ga0157370_10071755
241 Ga0157370_10137635
242 Ga0157369_10076646
243 Ga0157378_10751437
244 Ga0163162_10315278
245 Ga0157372_10011096
246 Ga0157372_10060546
247 Ga0157372_10090432
248 Ga0157375_12111331
249 Ga0163163_10007933
250 Ga0157380_10562294
251 Ga0209435_101225
252 Ga0209437_101341
253 Ga0209759_1010228
254 Ga0207705_10010747
255 Ga0207705_10753122
256 Ga0207654_10079546
257 Ga0207707_10019953
258 Ga0207660_10122779
259 Ga0207660_10137895
260 Ga0207657_10003398
261 Ga0207657_10010812
262 Ga0207657_10186745
263 Ga0207657_10682432
264 Ga0207700_10027414
265 Ga0207644_10390871
266 Ga0207690_10281046
267 Ga0207690_10582049
268 Ga0207706_10385156
269 Ga0207686_10063866
270 Ga0207667_10048880
271 Ga0207667_10327235
272 Ga0207712_10142332
273 Ga0207640_10221684
274 Ga0207639_10158261
275 Ga0207639_10247896
276 Ga0207639_10506295
277 Ga0207639_11121433
278 Ga0207674_10001696
279 Ga0207674_10003821
280 Ga0207698_10071286
281 Ga0207428_10060950
282 Ga0265339_10029976
283 Ga0316578_10034371
284 Ga0307413_10048725
285 Ga0307413_10054989
286 Ga0307413_10184180
287 Ga0307413_10201341
288 Ga0307410_10003366
289 Ga0307410_10050706
290 Ga0307410_10070897
291 Ga0307410_10296411
292 Ga0307410_10334051
293 Ga0307406_10057112
294 Ga0307406_10172761
295 Ga0307407_10005170
296 Ga0307412_10008862
297 Ga0307412_10075355
298 Ga0307409_100030202
299 Ga0307409_100051884
300 Ga0307409_100095822
301 Ga0307409_100415944
302 Ga0307409_100759326
303 Ga0307409_100824839
304 Ga0307416_100015695
305 Ga0307414_10013447
306 Ga0307414_10021774
307 Ga0307414_10022569
308 Ga0307414_10079344
309 Ga0307411_10000472
310 Ga0307411_10041214
311 Ga0307411_10076720
312 Ga0307411_10085589
313 Ga0307411_10598080
314 Ga0307415_100716780
315 Ga0373943_0101599
316 Ga0316574_0328540
317 Ga0373937_0010257
318 Ga0373937_0171355
319 Ga0316584_0005274
320 Ga0373925_0051736
321 Ga0395900_0091303
322 Ga0395900_0212208
323 Ga0395898_0055241
324 Ga0395905_0033185
325 Ga0395901_0100617
326 Ga0400490_52709
327 Ga0400483_053815
328 Ga0400483_200369
329 Ga0466963_0080952
330 Ga0453684_0646074
331 Ga0466970_0093746
332 Ga0451576_0328119
333 Ga0466958_0118586
334 Ga0495630_0201507
335 Ga0495666_0039240
336 Ga0495587_0057213
337 Ga0495667_0105653
338 Ga0495674_0068890
339 Ga0495674_0682074
340 Ga0495675_0076296
341 Ga0495675_0129203
342 Ga0495684_0059794
343 Ga0495602_0133589
344 Ga0496101_0366245
345 Ga0496102_0002158
346 Ga0496103_0084697
347 Ga0496107_0054592
348 Ga0496114_0007189
349 Ga0501039_0190260
350 Ga0501040_0226808
351 Ga0501046_0143528
352 Ga0501073_0009223
353 Ga0501073_0068744
354 nmdc:mga0k408_78_c1
355 nmdc:mga05p37_1584_c1
356 nmdc:mga05p37_180422_c1
357 nmdc:mga09592_360680_c1
358 nmdc:mga0qj67_583677_c1
359 nmdc:mga06r32_153025_c1
360 nmdc:mga08y16_907041_c1
361 nmdc:mga0n895_1086328_c1
362 nmdc:mga0n895_86078_c1
363 nmdc:mga0rr50_2285_c1
364 nmdc:mga0a205_383653_c1
365 Ga0495619_0053987
366 Ga0501084_0002346
367 Ga0501082_0269484
368 Ga0530510_0026201

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02397

Bac_transf

Bacterial sugar transferase

28

197

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g1n-assembly2.cif.gz_B structure of campylobacter concisus pglc i57m/q175m variant with modeled c-terminus 0.8677 16 196
8e37-assembly4.cif.gz_D structure of campylobacter concisus wild-type semet pglc 0.8536 19 195
8g1n-assembly1.cif.gz_A structure of campylobacter concisus pglc i57m/q175m variant with modeled c-terminus 0.8527 16 205
8g1n-assembly1.cif.gz_A structure of campylobacter concisus pglc i57m/q175m variant with modeled c-terminus 0.8201 16 205
8e37-assembly4.cif.gz_D structure of campylobacter concisus wild-type semet pglc 0.8159 19 195
ID Description Score Start End Superfamily
1to6B02 Alpha Beta;Alpha-Beta Complex;Glycerate kinase, domain 2;Glycerate kinase, domain 2 0.5736 42 74 3.90.1510.10
af_Q9FVR4_40_268_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.5608 49 75 3.40.50.1820
2i6sA03 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.5497 47 74 2.40.10.10
1nqyA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.5333 48 73 3.90.79.10
af_Q6AYF4_621_702_4.10.1240.30 Few Secondary Structures;Irregular;Hormone receptor fold; 0.4986 49 85 4.10.1240.30
ID Description Score Start End GO Terms
AF-A0A101FWS6-F1-model_v4 Putative glycosyltransferase 0.999 19 194 GO:0016020
GO:0016780
AF-A0A7H4K163-F1-model_v4 deleted 0.9976 19 193
AF-A0A3B9PA33-F1-model_v4 Bacterial sugar transferase domain-containing protein 0.9965 19 213 GO:0016020
GO:0016780
AF-E8MYZ8-F1-model_v4 Glycosyltransferase 0.9962 20 212 GO:0016780
AF-A0A449IQT3-F1-model_v4 UDP-N-acetylgalactosaminyltransferase (Undecaprenyl-phosphate galactose phosphotransferase) 0.9951 19 213 GO:0016780

Map