F282576

General Info

Members Datasets Scaffolds Average Seq Length
184 143 368 231

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10021727|Ga0163162_100217274
Length 256
Sequence MPRALTAAGIVLILPTPQRCQNGDAMIDILRADARGRTRLPWLDSRHTFSFGEYYDPAHMGYRALRVINDDVIGPGGGFGTHPHRDMEIVTYVLDGALQHRDSLGNGSLIRPGEVQRMSAGTGIRHSEHNASPDDPVHLLQIWLLPAELGIEPGYEQRPLPAAARGGLALVGSRDGTNGAVTIRQDVSMYAAQLDGGDQVVHPLAPGRHAWLHVARGNASINGDALHAGDGAAITGERQVAITADGPAEVLLFDLA

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
72 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
73 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
74 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
75 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
90 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
95 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
102 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
103 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
104 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
128 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
129 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
141 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.26
Rhizosphere 95.65
Stem 0
Stem Tuber 0
Unclassified 2.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10021727 3300013306 Bacteria 6320
2 rootH1_10020661 3300003323 Bacteria 21979
3 Ga0007410J51695_1026126 3300003574 Bacteria 1376
4 Ga0070683_100340168 3300005329 Bacteria 1429
5 Ga0070690_100133769 3300005330 Bacteria 1677
6 Ga0070691_10108688 3300005341 Bacteria 1385
7 Ga0070691_10272412 3300005341 Bacteria 915
8 Ga0070669_100304370 3300005353 Bacteria 1283
9 Ga0070674_100192520 3300005356 Bacteria 1570
10 Ga0070710_10069615 3300005437 Bacteria 2025
11 Ga0070701_10387840 3300005438 Bacteria 882
12 Ga0070711_100089708 3300005439 Bacteria 2212
13 Ga0070711_100129319 3300005439 Bacteria 1879
14 Ga0070711_100537914 3300005439 Bacteria 968
15 Ga0070705_100023599 3300005440 Bacteria 3307
16 Ga0070705_100087912 3300005440 Bacteria 1928
17 Ga0070694_100878345 3300005444 Bacteria 739
18 Ga0070678_100300528 3300005456 Bacteria 1364
19 Ga0070681_10207861 3300005458 Bacteria 1874
20 Ga0070679_100952800 3300005530 Bacteria 802
21 Ga0070672_100000755 3300005543 Bacteria 19242
22 Ga0070672_100390207 3300005543 Bacteria 1192
23 Ga0070693_100187918 3300005547 Bacteria 1334
24 Ga0070665_100040997 3300005548 Bacteria 4653
25 Ga0068855_100082867 3300005563 Bacteria 3717
26 Ga0068855_100141978 3300005563 Bacteria 2736
27 Ga0070664_100083563 3300005564 Bacteria 2755
28 Ga0068857_100213302 3300005577 Bacteria 1762
29 Ga0068859_100008000 3300005617 Bacteria 10717
30 Ga0068859_100855985 3300005617 Bacteria 995
31 Ga0068864_100710123 3300005618 Bacteria 983
32 Ga0068870_10125618 3300005840 Bacteria 1483
33 Ga0068863_100284820 3300005841 Bacteria 1601
34 Ga0068863_100433111 3300005841 Bacteria 1289
35 Ga0068858_100091463 3300005842 Bacteria 2832
36 Ga0068860_100002027 3300005843 Bacteria 21379
37 Ga0068862_100663881 3300005844 Bacteria 1007
38 Ga0097621_100635728 3300006237 Bacteria 978
39 Ga0068871_100321018 3300006358 Bacteria 1364
40 Ga0075433_10004937 3300006852 Bacteria 10446
41 Ga0075434_100943766 3300006871 Bacteria 877
42 Ga0097620_100008000 3300006931 Bacteria 10717
43 Ga0097620_100856118 3300006931 Bacteria 995
44 Ga0075435_100009310 3300007076 Bacteria 7102
45 Ga0105247_10023428 3300009101 Bacteria 3720
46 Ga0105242_10387693 3300009176 Bacteria 1300
47 Ga0105248_10156954 3300009177 Bacteria 2567
48 Ga0157374_10001505 3300013296 Bacteria 19620
49 Ga0157374_10880144 3300013296 Bacteria 913
50 Ga0157378_10362837 3300013297 Bacteria 1418
51 Ga0163162_10023640 3300013306 Bacteria 6068
52 Ga0163162_10027255 3300013306 Bacteria 5649
53 Ga0163162_10086100 3300013306 Bacteria 3220
54 Ga0157375_10582378 3300013308 Bacteria 1279
55 Ga0157375_11414145 3300013308 Bacteria 820
56 Ga0157376_10037646 3300014969 Unclassified 3930
57 Ga0207705_10000487 3300025909 Bacteria 33947
58 Ga0207707_10053842 3300025912 Bacteria 3503
59 Ga0207663_10281727 3300025916 Bacteria 1235
60 Ga0207652_10021858 3300025921 Bacteria 5284
61 Ga0207652_10819220 3300025921 Bacteria 826
62 Ga0207681_10218777 3300025923 Bacteria 1472
63 Ga0207664_10143287 3300025929 Bacteria 2024
64 Ga0207686_10353977 3300025934 Bacteria 1106
65 Ga0207669_10111128 3300025937 Bacteria 1837
66 Ga0207691_10378086 3300025940 Bacteria 1209
67 Ga0207668_10238958 3300025972 Bacteria 1469
68 Ga0207658_10047760 3300025986 Bacteria 3135
69 Ga0207703_10053924 3300026035 Bacteria 3269
70 Ga0207641_10201078 3300026088 Bacteria 1837
71 Ga0207641_10361406 3300026088 Bacteria 1386
72 Ga0207641_10634558 3300026088 Bacteria 1048
73 Ga0207676_10622283 3300026095 Bacteria 1039
74 Ga0207674_10286351 3300026116 Bacteria 1596
75 Ga0207683_10001826 3300026121 Bacteria 18819
76 Ga0209973_1019004 3300027252 Unclassified 896
77 Ga0209971_1063385 3300027682 Bacteria 895
78 Ga0209974_10009523 3300027876 Unclassified 3299
79 Ga0268264_10003365 3300028381 Bacteria 13820
80 Ga0265336_10012578 3300028666 Bacteria 2844
81 Ga0265338_10001146 3300028800 Bacteria 43787
82 Ga0265338_10040722 3300028800 Bacteria 4358
83 Ga0265328_10000231 3300031239 Bacteria 25706
84 Ga0265320_10000194 3300031240 Bacteria 50070
85 Ga0265320_10015275 3300031240 Bacteria 4344
86 Ga0265320_10059837 3300031240 Bacteria 1820
87 Ga0265329_10038406 3300031242 Bacteria 1540
88 Ga0265340_10176339 3300031247 Bacteria 967
89 Ga0265339_10001498 3300031249 Bacteria 17278
90 Ga0265339_10030064 3300031249 Bacteria 3078
91 Ga0307408_100795743 3300031548 Bacteria 858
92 Ga0316575_10010651 3300031665 Bacteria 3387
93 Ga0265342_10000342 3300031712 Bacteria 52184
94 Ga0265342_10001222 3300031712 Bacteria 24312
95 Ga0316576_10003772 3300031727 Bacteria 8952
96 Ga0316576_10030572 3300031727 Bacteria 3814
97 Ga0316576_10358868 3300031727 Bacteria 1084
98 Ga0316578_10008395 3300031728 Bacteria 5253
99 Ga0316577_10012853 3300031733 Bacteria 4568
100 Ga0307406_10564757 3300031901 Bacteria 933
101 Ga0307412_10152964 3300031911 Bacteria 1705
102 Ga0307416_100343400 3300032002 Bacteria 1507
103 Ga0373923_0103171 3300035111 Bacteria 1260
104 Ga0373936_0323343 3300035113 Bacteria 699
105 Ga0373953_0005217 3300035117 Bacteria 4200
106 Ga0373953_0049028 3300035117 Bacteria 1703
107 Ga0373954_0010284 3300035118 Bacteria 4128
108 Ga0373956_0143918 3300035119 Bacteria 1120
109 Ga0373956_0254826 3300035119 Bacteria 834
110 Ga0373957_0027280 3300035120 Bacteria 2074
111 Ga0373955_0013876 3300035172 Bacteria 3910
112 Ga0373955_0068571 3300035172 Bacteria 1977
113 Ga0373927_0167101 3300035695 Bacteria 1442
114 Ga0373933_0073794 3300035724 Bacteria 2079
115 Ga0373933_0112896 3300035724 Bacteria 1697
116 Ga0373937_0000880 3300036401 Bacteria 25714
117 Ga0373937_0007999 3300036401 Bacteria 9169
118 Ga0373937_0013038 3300036401 Bacteria 7321
119 Ga0373937_0232040 3300036401 Bacteria 1738
120 Ga0316582_0024091 3300036647 Bacteria 3638
121 Ga0316582_0300768 3300036647 Bacteria 1102
122 Ga0316584_0030813 3300036712 Bacteria 3964
123 Ga0316584_0051819 3300036712 Bacteria 3069
124 Ga0373925_0185470 3300037068 Bacteria 1649
125 Ga0395900_0098755 3300037418 Bacteria 3000
126 Ga0395905_0348709 3300037471 Bacteria 1372
127 Ga0400483_236532 3300039062 Bacteria 29460
128 Ga0436360_0375849 3300039438 Bacteria 1639
129 Ga0451577_0001521 3300042876 Bacteria 30541
130 Ga0451577_0003961 3300042876 Bacteria 15967
131 Ga0453684_0010534 3300044712 Bacteria 15785
132 Ga0495629_0162656 3300046459 Unclassified 1550
133 Ga0495580_0403314 3300046472 Bacteria 922
134 Ga0495652_0397720 3300046529 Bacteria 976
135 Ga0495657_0098931 3300046675 Bacteria 1861
136 Ga0495599_0318133 3300046678 Bacteria 937
137 Ga0495647_0129425 3300046681 Bacteria 1068
138 Ga0495669_0037859 3300046684 Bacteria 2136
139 Ga0495680_0092358 3300047322 Bacteria 2267
140 Ga0496104_0643091 3300048907 Bacteria 970
141 Ga0496104_0822693 3300048907 Bacteria 835
142 Ga0496106_0343371 3300048909 Bacteria 1199
143 Ga0496109_0106621 3300048912 Bacteria 2603
144 Ga0496112_0242689 3300048915 Bacteria 1754
145 Ga0496114_0684935 3300048917 Bacteria 900
146 Ga0501033_0020563 3300049570 Bacteria 4988
147 Ga0501036_0025407 3300049572 Bacteria 4996
148 Ga0501038_0008587 3300049574 Bacteria 9376
149 Ga0501039_0001197 3300049575 Bacteria 19024
150 Ga0501040_0000127 3300049576 Bacteria 40573
151 Ga0501042_0000246 3300049578 Bacteria 26241
152 Ga0501043_0037442 3300049579 Bacteria 3816
153 Ga0501043_0286094 3300049579 Bacteria 1263
154 Ga0501046_0000014 3300049580 Bacteria 298314
155 Ga0501046_0010299 3300049580 Bacteria 8043
156 Ga0501048_0014207 3300049582 Bacteria 5898
157 Ga0501068_0022570 3300049584 Bacteria 3681
158 Ga0501070_0389400 3300049586 Bacteria 1128
159 Ga0501071_0000271 3300049587 Bacteria 24477
160 Ga0501072_0003073 3300049588 Bacteria 12583
161 Ga0501073_0109500 3300049589 Bacteria 1916
162 Ga0501075_0000313 3300049591 Bacteria 27151
163 Ga0501076_0004044 3300049592 Bacteria 10363
164 Ga0501076_0656022 3300049592 Bacteria 866
165 Ga0501077_0000289 3300049593 Bacteria 29781
166 Ga0501233_056399 3300049668 Unclassified 964
167 Ga0501235_003763 3300049669 Bacteria 3278
168 Ga0501079_0004665 3300049741 Bacteria 10152
169 Ga0501080_0296453 3300049742 Bacteria 1467
170 Ga0501081_0001121 3300049743 Bacteria 16125
171 Ga0501083_0082916 3300049744 Bacteria 2124
172 Ga0501279_055851 3300049775 Bacteria 636
173 Ga0501035_0086796 3300049822 Bacteria 2757
174 Ga0501045_0006201 3300049824 Bacteria 8278
175 Ga0501045_0417962 3300049824 Bacteria 998
176 nmdc:mga09592_846188_c1 3300050508 Bacteria 772
177 Ga0495619_0079417 3300053085 Bacteria 2207
178 Ga0495619_0221484 3300053085 Bacteria 1311
179 Ga0501084_0009420 3300054114 Bacteria 8081
180 Ga0590071_020404 3300059421 Bacteria 1561
181 Ga0590077_005806 3300059426 Bacteria 2529
182 Ga0501082_0001440 3300060353 Bacteria 20899
183 Ga0501082_0035540 3300060353 Bacteria 4295
184 Ga0530510_0003459 3300061734 Bacteria 10856
185 Ga0163162_10021727
186 rootH1_10020661
187 Ga0007410J51695_1026126
188 Ga0070683_100340168
189 Ga0070690_100133769
190 Ga0070691_10108688
191 Ga0070691_10272412
192 Ga0070669_100304370
193 Ga0070674_100192520
194 Ga0070710_10069615
195 Ga0070701_10387840
196 Ga0070711_100089708
197 Ga0070711_100129319
198 Ga0070711_100537914
199 Ga0070705_100023599
200 Ga0070705_100087912
201 Ga0070694_100878345
202 Ga0070678_100300528
203 Ga0070681_10207861
204 Ga0070679_100952800
205 Ga0070672_100000755
206 Ga0070672_100390207
207 Ga0070693_100187918
208 Ga0070665_100040997
209 Ga0068855_100082867
210 Ga0068855_100141978
211 Ga0070664_100083563
212 Ga0068857_100213302
213 Ga0068859_100008000
214 Ga0068859_100855985
215 Ga0068864_100710123
216 Ga0068870_10125618
217 Ga0068863_100284820
218 Ga0068863_100433111
219 Ga0068858_100091463
220 Ga0068860_100002027
221 Ga0068862_100663881
222 Ga0097621_100635728
223 Ga0068871_100321018
224 Ga0075433_10004937
225 Ga0075434_100943766
226 Ga0097620_100008000
227 Ga0097620_100856118
228 Ga0075435_100009310
229 Ga0105247_10023428
230 Ga0105242_10387693
231 Ga0105248_10156954
232 Ga0157374_10001505
233 Ga0157374_10880144
234 Ga0157378_10362837
235 Ga0163162_10023640
236 Ga0163162_10027255
237 Ga0163162_10086100
238 Ga0157375_10582378
239 Ga0157375_11414145
240 Ga0157376_10037646
241 Ga0207705_10000487
242 Ga0207707_10053842
243 Ga0207663_10281727
244 Ga0207652_10021858
245 Ga0207652_10819220
246 Ga0207681_10218777
247 Ga0207664_10143287
248 Ga0207686_10353977
249 Ga0207669_10111128
250 Ga0207691_10378086
251 Ga0207668_10238958
252 Ga0207658_10047760
253 Ga0207703_10053924
254 Ga0207641_10201078
255 Ga0207641_10361406
256 Ga0207641_10634558
257 Ga0207676_10622283
258 Ga0207674_10286351
259 Ga0207683_10001826
260 Ga0209973_1019004
261 Ga0209971_1063385
262 Ga0209974_10009523
263 Ga0268264_10003365
264 Ga0265336_10012578
265 Ga0265338_10001146
266 Ga0265338_10040722
267 Ga0265328_10000231
268 Ga0265320_10000194
269 Ga0265320_10015275
270 Ga0265320_10059837
271 Ga0265329_10038406
272 Ga0265340_10176339
273 Ga0265339_10001498
274 Ga0265339_10030064
275 Ga0307408_100795743
276 Ga0316575_10010651
277 Ga0265342_10000342
278 Ga0265342_10001222
279 Ga0316576_10003772
280 Ga0316576_10030572
281 Ga0316576_10358868
282 Ga0316578_10008395
283 Ga0316577_10012853
284 Ga0307406_10564757
285 Ga0307412_10152964
286 Ga0307416_100343400
287 Ga0373923_0103171
288 Ga0373936_0323343
289 Ga0373953_0005217
290 Ga0373953_0049028
291 Ga0373954_0010284
292 Ga0373956_0143918
293 Ga0373956_0254826
294 Ga0373957_0027280
295 Ga0373955_0013876
296 Ga0373955_0068571
297 Ga0373927_0167101
298 Ga0373933_0073794
299 Ga0373933_0112896
300 Ga0373937_0000880
301 Ga0373937_0007999
302 Ga0373937_0013038
303 Ga0373937_0232040
304 Ga0316582_0024091
305 Ga0316582_0300768
306 Ga0316584_0030813
307 Ga0316584_0051819
308 Ga0373925_0185470
309 Ga0395900_0098755
310 Ga0395905_0348709
311 Ga0400483_236532
312 Ga0436360_0375849
313 Ga0451577_0001521
314 Ga0451577_0003961
315 Ga0453684_0010534
316 Ga0495629_0162656
317 Ga0495580_0403314
318 Ga0495652_0397720
319 Ga0495657_0098931
320 Ga0495599_0318133
321 Ga0495647_0129425
322 Ga0495669_0037859
323 Ga0495680_0092358
324 Ga0496104_0643091
325 Ga0496104_0822693
326 Ga0496106_0343371
327 Ga0496109_0106621
328 Ga0496112_0242689
329 Ga0496114_0684935
330 Ga0501033_0020563
331 Ga0501036_0025407
332 Ga0501038_0008587
333 Ga0501039_0001197
334 Ga0501040_0000127
335 Ga0501042_0000246
336 Ga0501043_0037442
337 Ga0501043_0286094
338 Ga0501046_0000014
339 Ga0501046_0010299
340 Ga0501048_0014207
341 Ga0501068_0022570
342 Ga0501070_0389400
343 Ga0501071_0000271
344 Ga0501072_0003073
345 Ga0501073_0109500
346 Ga0501075_0000313
347 Ga0501076_0004044
348 Ga0501076_0656022
349 Ga0501077_0000289
350 Ga0501233_056399
351 Ga0501235_003763
352 Ga0501079_0004665
353 Ga0501080_0296453
354 Ga0501081_0001121
355 Ga0501083_0082916
356 Ga0501279_055851
357 Ga0501035_0086796
358 Ga0501045_0006201
359 Ga0501045_0417962
360 nmdc:mga09592_846188_c1
361 Ga0495619_0079417
362 Ga0495619_0221484
363 Ga0501084_0009420
364 Ga0590071_020404
365 Ga0590077_005806
366 Ga0501082_0001440
367 Ga0501082_0035540
368 Ga0530510_0003459

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17954

Pirin_C_2

Quercetinase C-terminal cupin domain

170

255

0.99

PF02678

Pirin

Pirin

30

144

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9895 1 230
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9872 1 230
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9809 1 230
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9744 1 230
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.8726 37 120
ID Description Score Start End Superfamily
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9881 11 135 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9838 13 131 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.98 11 135 2.60.120.10
1tq5A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9777 138 230 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9677 13 131 2.60.120.10
ID Description Score Start End GO Terms
AF-F4HAY5-F1-model_v4 Pirin N-terminal domain-containing protein 0.998 1 118
AF-A0A2D0J2C0-F1-model_v4 Quercetin 2,3-dioxygenase 0.9969 1 120 GO:0051213
AF-A0A658NQL7-F1-model_v4 Pirin family protein 0.9968 1 131
AF-B8BWL0-F1-model_v4 Pirin N-terminal domain-containing protein 0.9964 24 129
AF-A0A359LRR0-F1-model_v4 Quercetin 2,3-dioxygenase 0.9957 43 129 GO:0051213

Map