F282571

General Info

Members Datasets Scaffolds Average Seq Length
184 103 184 380

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10046934|Ga0157378_100469343
Length 436
Sequence LSYGFATPMRGKSMTCRTGCFFLLRVFDPADGHRPQSFLDAVVRQVEDLPRIGVAEPIRLNQIMTLQQTLTDLVAIDSVSSRTNQQVISYLEAKCQSLGFQTERQLHTDESGVAKINLIAKTAANDDLTELVLVGHTDTVPFDPQWTDALRLKEKDGKLFGRGACDTKAFIAAALTAVEQLDLAKLSRPLTLVFTADEEIGCLGAKRLAAAKALSARYAIVGEPTSLQPIRAGKGYCLAEIVVRGKEAHSAYPALGASAIFRAARLMSRIESIAGELQGDQRAGFDPPFTTLNIGLVKGGTAKNISPAECRLTLEWRTITAQPSDHVLNLVYAAVEELKRADSDFDCEINASRADESFETPADSPIVKFLEEQTQKSAGTVAFGTEAPSMIALGADAVVFGPGDIRVAHRTGEFVPVEQLTRCVDILRGSIQKFCL

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
91 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
92 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
93 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
94 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
95 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
96 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
100 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
101 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
103 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 1.09
Rhizosphere 95.65
Stem 0
Stem Tuber 0
Unclassified 2.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000551 3300000546 Bacteria 6459
2 JGI24748J21848_1000010 3300002074 Bacteria 166979
3 JGI24034J26672_10000001 3300002239 Bacteria 1118280
4 Ga0065704_10018075 3300005289 Bacteria 1873
5 Ga0065715_10107760 3300005293 Bacteria 2744
6 Ga0065707_10011484 3300005295 Unclassified 3329
7 Ga0065707_10148075 3300005295 Bacteria 1690
8 Ga0070690_100155299 3300005330 Unclassified 1564
9 Ga0070670_100038845 3300005331 Unclassified 4093
10 Ga0070670_100102418 3300005331 Bacteria 2466
11 Ga0070666_10165843 3300005335 Bacteria 1545
12 Ga0070687_100001816 3300005343 Bacteria 7713
13 Ga0070673_100120366 3300005364 Bacteria 2189
14 Ga0070703_10000015 3300005406 Bacteria 87420
15 Ga0070694_100001151 3300005444 Bacteria 15188
16 Ga0070694_100027397 3300005444 Bacteria 3700
17 Ga0070694_100038001 3300005444 Bacteria 3196
18 Ga0070708_100037314 3300005445 Bacteria 4238
19 Ga0070708_100245619 3300005445 Bacteria 1681
20 Ga0070681_10001543 3300005458 Bacteria 20396
21 Ga0070706_100001884 3300005467 Bacteria 21660
22 Ga0070706_100015790 3300005467 Bacteria 6972
23 Ga0070706_100050883 3300005467 Bacteria 3822
24 Ga0070706_100091780 3300005467 Unclassified 2817
25 Ga0070707_100000612 3300005468 Bacteria 35823
26 Ga0070707_100014454 3300005468 Bacteria 7398
27 Ga0070707_100172896 3300005468 Bacteria 2105
28 Ga0070707_100227150 3300005468 Bacteria 1818
29 Ga0070698_100000398 3300005471 Bacteria 45901
30 Ga0070698_100038071 3300005471 Unclassified 4956
31 Ga0070698_100374698 3300005471 Unclassified 1356
32 Ga0070699_100062604 3300005518 Bacteria 3225
33 Ga0070697_100018082 3300005536 Bacteria 5555
34 Ga0070697_100071713 3300005536 Bacteria 2842
35 Ga0070697_100079549 3300005536 Bacteria 2699
36 Ga0070697_100102888 3300005536 Unclassified 2373
37 Ga0070686_100010889 3300005544 Bacteria 5147
38 Ga0070686_100065165 3300005544 Bacteria 2365
39 Ga0070693_100024545 3300005547 Bacteria 3234
40 Ga0070704_100009946 3300005549 Bacteria 5774
41 Ga0070704_100010945 3300005549 Bacteria 5534
42 Ga0070664_100052531 3300005564 Bacteria 3453
43 Ga0068859_100005876 3300005617 Bacteria 12454
44 Ga0068859_100200720 3300005617 Bacteria 2079
45 Ga0068864_100077985 3300005618 Unclassified 2898
46 Ga0068864_100163167 3300005618 Unclassified 2027
47 Ga0068866_10002732 3300005718 Bacteria 7279
48 Ga0068861_100084062 3300005719 Bacteria 2498
49 Ga0068858_100000005 3300005842 Bacteria 305830
50 Ga0068858_100088385 3300005842 Bacteria 2883
51 Ga0068860_100028627 3300005843 Bacteria 5363
52 Ga0068860_100134706 3300005843 Bacteria 2372
53 Ga0068862_100026625 3300005844 Bacteria 4861
54 Ga0081539_10000571 3300005985 Bacteria 76141
55 Ga0070715_10000019 3300006163 Bacteria 122990
56 Ga0070716_100000004 3300006173 Bacteria 296614
57 Ga0068871_100135578 3300006358 Bacteria 2091
58 Ga0075434_100003175 3300006871 Bacteria 14650
59 Ga0075429_100101160 3300006880 Bacteria 2516
60 Ga0075429_100120030 3300006880 Bacteria 2298
61 Ga0075436_100000042 3300006914 Bacteria 78521
62 Ga0097620_100005876 3300006931 Bacteria 12454
63 Ga0097620_100200702 3300006931 Bacteria 2079
64 Ga0075435_100018399 3300007076 Bacteria 5313
65 Ga0105240_10005829 3300009093 Bacteria 18269
66 Ga0105240_10112964 3300009093 Bacteria 3283
67 Ga0111539_10016081 3300009094 Bacteria 9285
68 Ga0105245_10139505 3300009098 Bacteria 2281
69 Ga0105247_10000002 3300009101 Bacteria 724587
70 Ga0105247_10114890 3300009101 Unclassified 1736
71 Ga0114129_10006111 3300009147 Bacteria 17076
72 Ga0114129_10573762 3300009147 Bacteria 1465
73 Ga0105243_10001709 3300009148 Bacteria 18920
74 Ga0105243_10004957 3300009148 Bacteria 10434
75 Ga0105242_10000301 3300009176 Bacteria 39312
76 Ga0105242_10000554 3300009176 Bacteria 29570
77 Ga0105242_10008643 3300009176 Bacteria 7817
78 Ga0105242_10091148 3300009176 Bacteria 2566
79 Ga0105248_10042494 3300009177 Bacteria 5098
80 Ga0105249_10000375 3300009553 Bacteria 44344
81 Ga0105249_10184624 3300009553 Bacteria 2031
82 Ga0105246_10191923 3300011119 Unclassified 1582
83 Ga0157378_10000003 3300013297 Bacteria 203725
84 Ga0157378_10006184 3300013297 Bacteria 10474
85 Ga0157378_10014437 3300013297 Bacteria 6916
86 Ga0157378_10046934 3300013297 Unclassified 3840
87 Ga0157378_10182571 3300013297 Bacteria 1974
88 Ga0163162_10000162 3300013306 Bacteria 61820
89 Ga0157375_10001002 3300013308 Bacteria 24391
90 Ga0157375_10151629 3300013308 Bacteria 2454
91 Ga0157375_10369182 3300013308 Bacteria 1601
92 Ga0157380_10061677 3300014326 Bacteria 3001
93 Ga0157380_10110748 3300014326 Bacteria 2307
94 Ga0157377_10127007 3300014745 Bacteria 1553
95 Ga0213875_10000024 3300021388 Bacteria 200333
96 Ga0207672_1000654 3300025223 Bacteria 4028
97 Ga0209675_1006108 3300025291 Bacteria 4904
98 Ga0207653_10000007 3300025885 Bacteria 198873
99 Ga0207710_10000002 3300025900 Bacteria 1251998
100 Ga0207685_10000021 3300025905 Bacteria 131248
101 Ga0207684_10001316 3300025910 Bacteria 27254
102 Ga0207684_10008528 3300025910 Bacteria 9117
103 Ga0207684_10023238 3300025910 Bacteria 5294
104 Ga0207695_10005295 3300025913 Bacteria 17197
105 Ga0207695_10081128 3300025913 Bacteria 3283
106 Ga0207662_10003961 3300025918 Bacteria 7716
107 Ga0207662_10015562 3300025918 Unclassified 4282
108 Ga0207646_10010517 3300025922 Bacteria 9030
109 Ga0207646_10014087 3300025922 Bacteria 7606
110 Ga0207646_10055714 3300025922 Bacteria 3534
111 Ga0207687_10109098 3300025927 Bacteria 2050
112 Ga0207644_10009353 3300025931 Bacteria 6436
113 Ga0207686_10000018 3300025934 Bacteria 189717
114 Ga0207686_10000021 3300025934 Bacteria 181793
115 Ga0207686_10000132 3300025934 Bacteria 58994
116 Ga0207686_10000436 3300025934 Bacteria 28156
117 Ga0207709_10000069 3300025935 Bacteria 183367
118 Ga0207709_10002302 3300025935 Bacteria 12096
119 Ga0207665_10000006 3300025939 Bacteria 184957
120 Ga0207711_10112367 3300025941 Unclassified 2424
121 Ga0207651_10054306 3300025960 Bacteria 2744
122 Ga0207712_10000313 3300025961 Bacteria 44454
123 Ga0207677_10028822 3300026023 Bacteria 3519
124 Ga0207703_10000150 3300026035 Bacteria 80047
125 Ga0207703_10129063 3300026035 Bacteria 2181
126 Ga0207648_10107913 3300026089 Bacteria 2444
127 Ga0207648_10175907 3300026089 Unclassified 1893
128 Ga0207676_10097589 3300026095 Bacteria 2428
129 Ga0207675_100013859 3300026118 Bacteria 7518
130 Ga0207675_100076941 3300026118 Bacteria 3125
131 Ga0207428_10006805 3300027907 Bacteria 10484
132 Ga0268264_10022412 3300028381 Bacteria 5158
133 Ga0268264_10113221 3300028381 Bacteria 2380
134 Ga0307515_10252061 3300028794 Bacteria 1516
135 Ga0307416_100246696 3300032002 Unclassified 1735
136 Ga0395905_0004567 3300037471 Bacteria 14327
137 Ga0436364_0991316 3300037853 Bacteria 187962
138 Ga0436365_1637931 3300039437 Bacteria 8074
139 Ga0451577_0000553 3300042876 Bacteria 61075
140 Ga0451577_0024527 3300042876 Bacteria 5485
141 Ga0451577_0074209 3300042876 Bacteria 3034
142 Ga0451577_0094051 3300042876 Bacteria 2676
143 Ga0451577_0095180 3300042876 Bacteria 2659
144 Ga0451577_0255572 3300042876 Bacteria 1586
145 Ga0453683_0000305 3300044673 Bacteria 61759
146 Ga0453683_0001528 3300044673 Bacteria 19734
147 Ga0453683_0001973 3300044673 Bacteria 16615
148 Ga0453683_0020712 3300044673 Bacteria 4202
149 Ga0453683_0085140 3300044673 Bacteria 1980
150 Ga0453683_0137994 3300044673 Unclassified 1538
151 Ga0453684_0000362 3300044712 Bacteria 187378
152 Ga0453684_0001516 3300044712 Bacteria 65183
153 Ga0453684_0003059 3300044712 Bacteria 38816
154 Ga0453684_0011542 3300044712 Bacteria 14779
155 Ga0453684_0012840 3300044712 Bacteria 13726
156 Ga0453684_0012970 3300044712 Bacteria 13635
157 Ga0453684_0039526 3300044712 Bacteria 6426
158 Ga0453684_0041642 3300044712 Bacteria 6207
159 Ga0453684_0044794 3300044712 Bacteria 5913
160 Ga0453684_0471807 3300044712 Bacteria 1393
161 Ga0451576_0000321 3300045051 Bacteria 116475
162 Ga0451576_0001587 3300045051 Bacteria 38211
163 Ga0451576_0038345 3300045051 Bacteria 5071
164 Ga0451576_0044737 3300045051 Bacteria 4664
165 Ga0451576_0098251 3300045051 Bacteria 3045
166 Ga0451576_0223522 3300045051 Bacteria 1966
167 Ga0451576_0335866 3300045051 Bacteria 1581
168 Ga0451576_0357071 3300045051 Bacteria 1530
169 Ga0495598_0013594 3300046537 Unclassified 2021
170 Ga0496106_0001064 3300048909 Bacteria 20248
171 Ga0496114_0286914 3300048917 Bacteria 1452
172 Ga0496126_0043646 3300048929 Unclassified 4134
173 Ga0501075_0145384 3300049591 Bacteria 1807
174 Ga0501079_0116723 3300049741 Bacteria 2075
175 Ga0501081_0169967 3300049743 Bacteria 1574
176 Ga0501044_0012436 3300049823 Bacteria 9217
177 nmdc:mga09592_142007_c1 3300050508 Bacteria 2070
178 nmdc:mga08y16_12418_c1 3300050511 Bacteria 8962
179 nmdc:mga0rr50_151_c1 3300050513 Bacteria 37856
180 nmdc:mga0rr50_55181_c1 3300050513 Unclassified 2963
181 nmdc:mga08x19_61_c1 3300050514 Bacteria 114972
182 Ga0501084_0364794 3300054114 Bacteria 1221
183 Ga0530510_0002925 3300061734 Bacteria 11716
184 Ga0530510_0125740 3300061734 Bacteria 1885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0357071 Ga0451576_0357071_13_996 324
2 3300048929 Ga0496126_0043646 Ga0496126_0043646_386_1462 356
3 3300025918 Ga0207662_10015562 Ga0207662_100155621 360
4 3300044673 Ga0453683_0001528 Ga0453683_0001528_12385_13500 363
5 3300005564 Ga0070664_100052531 Ga0070664_1000525312 367
6 3300006358 Ga0068871_100135578 Ga0068871_1001355782 367
7 3300011119 Ga0105246_10191923 Ga0105246_101919232 367
8 3300025291 Ga0209675_1006108 Ga0209675_10061084 367
9 3300026095 Ga0207676_10097589 Ga0207676_100975892 367
10 3300049823 Ga0501044_0012436 Ga0501044_0012436_5563_6750 367
11 3300006880 Ga0075429_100120030 Ga0075429_1001200302 368
12 3300042876 Ga0451577_0000553 Ga0451577_0000553_9537_10652 368
13 3300042876 Ga0451577_0024527 Ga0451577_0024527_4079_5194 368
14 3300042876 Ga0451577_0074209 Ga0451577_0074209_283_1398 368
15 3300042876 Ga0451577_0095180 Ga0451577_0095180_614_1732 368
16 3300044673 Ga0453683_0000305 Ga0453683_0000305_21990_23105 368
17 3300044673 Ga0453683_0001973 Ga0453683_0001973_13217_14332 368
18 3300044673 Ga0453683_0020712 Ga0453683_0020712_694_1809 368
19 3300044712 Ga0453684_0000362 Ga0453684_0000362_176727_177842 368
20 3300044712 Ga0453684_0011542 Ga0453684_0011542_1119_2234 368
21 3300044712 Ga0453684_0012840 Ga0453684_0012840_1359_2471 368
22 3300044712 Ga0453684_0039526 Ga0453684_0039526_2673_3788 368
23 3300045051 Ga0451576_0000321 Ga0451576_0000321_9859_10974 368
24 3300045051 Ga0451576_0001587 Ga0451576_0001587_14273_15388 368
25 3300045051 Ga0451576_0038345 Ga0451576_0038345_1435_2550 368
26 3300045051 Ga0451576_0044737 Ga0451576_0044737_3137_4252 368
27 3300045051 Ga0451576_0098251 Ga0451576_0098251_1859_2974 368
28 3300049591 Ga0501075_0145384 Ga0501075_0145384_58_1170 368
29 3300049741 Ga0501079_0116723 Ga0501079_0116723_670_1785 368
30 3300049743 Ga0501081_0169967 Ga0501081_0169967_164_1279 368
31 3300050508 nmdc:mga09592_142007_c1 nmdc:mga09592_142007_c1_754_1869 368
32 3300054114 Ga0501084_0364794 Ga0501084_0364794_61_1176 368
33 3300061734 Ga0530510_0002925 Ga0530510_0002925_2543_3658 368
34 3300061734 Ga0530510_0125740 Ga0530510_0125740_26_1138 368
35 3300005458 Ga0070681_10001543 Ga0070681_1000154315 369
36 3300005547 Ga0070693_100024545 Ga0070693_1000245453 369
37 3300009093 Ga0105240_10112964 Ga0105240_101129642 369
38 3300025913 Ga0207695_10081128 Ga0207695_100811282 369
39 3300042876 Ga0451577_0094051 Ga0451577_0094051_979_2097 369
40 3300042876 Ga0451577_0255572 Ga0451577_0255572_340_1467 369
41 3300044712 Ga0453684_0001516 Ga0453684_0001516_6046_7173 369
42 3300044712 Ga0453684_0003059 Ga0453684_0003059_1772_2899 369
43 3300044712 Ga0453684_0012970 Ga0453684_0012970_6869_7996 369
44 3300044712 Ga0453684_0041642 Ga0453684_0041642_376_1503 369
45 3300044712 Ga0453684_0044794 Ga0453684_0044794_4446_5573 369
46 3300044712 Ga0453684_0471807 Ga0453684_0471807_132_1250 369
47 3300045051 Ga0451576_0223522 Ga0451576_0223522_791_1918 369
48 3300045051 Ga0451576_0335866 Ga0451576_0335866_223_1350 369
49 3300005289 Ga0065704_10018075 Ga0065704_100180752 370
50 3300005295 Ga0065707_10011484 Ga0065707_100114842 370
51 3300005471 Ga0070698_100000398 Ga0070698_10000039814 370
52 3300005544 Ga0070686_100065165 Ga0070686_1000651652 370
53 3300005617 Ga0068859_100005876 Ga0068859_1000058761 370
54 3300005718 Ga0068866_10002732 Ga0068866_100027327 370
55 3300005844 Ga0068862_100026625 Ga0068862_1000266253 370
56 3300006880 Ga0075429_100101160 Ga0075429_1001011602 370
57 3300006931 Ga0097620_100005876 Ga0097620_1000058761 370
58 3300009093 Ga0105240_10005829 Ga0105240_100058294 370
59 3300009094 Ga0111539_10016081 Ga0111539_100160813 370
60 3300009553 Ga0105249_10000375 Ga0105249_1000037539 370
61 3300009553 Ga0105249_10184624 Ga0105249_101846242 370
62 3300013297 Ga0157378_10006184 Ga0157378_100061849 370
63 3300013297 Ga0157378_10046934 Ga0157378_100469343 370
64 3300013306 Ga0163162_10000162 Ga0163162_100001625 370
65 3300014326 Ga0157380_10061677 Ga0157380_100616772 370
66 3300014326 Ga0157380_10110748 Ga0157380_101107482 370
67 3300025913 Ga0207695_10005295 Ga0207695_1000529511 370
68 3300025961 Ga0207712_10000313 Ga0207712_100003135 370
69 3300026089 Ga0207648_10175907 Ga0207648_101759072 370
70 3300026118 Ga0207675_100076941 Ga0207675_1000769412 370
71 3300027907 Ga0207428_10006805 Ga0207428_100068059 370
72 3300050511 nmdc:mga08y16_12418_c1 nmdc:mga08y16_12418_c1_4806_5924 370
73 3300005295 Ga0065707_10148075 Ga0065707_101480751 371
74 3300005444 Ga0070694_100038001 Ga0070694_1000380011 371
75 3300005468 Ga0070707_100000612 Ga0070707_1000006123 371
76 3300005549 Ga0070704_100009946 Ga0070704_1000099465 371
77 3300021388 Ga0213875_10000024 Ga0213875_1000002437 371
78 3300025922 Ga0207646_10055714 Ga0207646_100557143 371
79 3300037471 Ga0395905_0004567 Ga0395905_0004567_1863_2996 371
80 3300037853 Ga0436364_0991316 Ga0436364_0991316_54093_55235 371
81 3300005467 Ga0070706_100001884 Ga0070706_1000018843 372
82 3300005468 Ga0070707_100172896 Ga0070707_1001728961 372
83 3300005536 Ga0070697_100071713 Ga0070697_1000717132 372
84 3300025910 Ga0207684_10008528 Ga0207684_100085284 372
85 3300025934 Ga0207686_10000436 Ga0207686_1000043622 372
86 3300025935 Ga0207709_10002302 Ga0207709_100023026 372
87 3300032002 Ga0307416_100246696 Ga0307416_1002466962 372
88 3300005406 Ga0070703_10000015 Ga0070703_1000001556 373
89 3300005518 Ga0070699_100062604 Ga0070699_1000626042 373
90 3300009147 Ga0114129_10573762 Ga0114129_105737621 373
91 3300025885 Ga0207653_10000007 Ga0207653_10000007128 373
92 3300025910 Ga0207684_10023238 Ga0207684_100232382 373
93 3300025934 Ga0207686_10000132 Ga0207686_1000013231 373
94 3300005293 Ga0065715_10107760 Ga0065715_101077602 374
95 3300005330 Ga0070690_100155299 Ga0070690_1001552992 374
96 3300005331 Ga0070670_100038845 Ga0070670_1000388452 374
97 3300005331 Ga0070670_100102418 Ga0070670_1001024182 374
98 3300005335 Ga0070666_10165843 Ga0070666_101658431 374
99 3300005343 Ga0070687_100001816 Ga0070687_1000018165 374
100 3300005364 Ga0070673_100120366 Ga0070673_1001203662 374
101 3300005445 Ga0070708_100037314 Ga0070708_1000373143 374
102 3300005445 Ga0070708_100245619 Ga0070708_1002456192 374
103 3300005467 Ga0070706_100015790 Ga0070706_1000157905 374
104 3300005468 Ga0070707_100227150 Ga0070707_1002271502 374
105 3300005471 Ga0070698_100374698 Ga0070698_1003746982 374
106 3300005536 Ga0070697_100018082 Ga0070697_1000180825 374
107 3300005536 Ga0070697_100079549 Ga0070697_1000795491 374
108 3300005544 Ga0070686_100010889 Ga0070686_1000108893 374
109 3300005617 Ga0068859_100200720 Ga0068859_1002007202 374
110 3300005618 Ga0068864_100077985 Ga0068864_1000779852 374
111 3300005618 Ga0068864_100163167 Ga0068864_1001631671 374
112 3300005719 Ga0068861_100084062 Ga0068861_1000840621 374
113 3300005842 Ga0068858_100088385 Ga0068858_1000883853 374
114 3300005843 Ga0068860_100028627 Ga0068860_1000286272 374
115 3300005843 Ga0068860_100134706 Ga0068860_1001347062 374
116 3300005985 Ga0081539_10000571 Ga0081539_1000057130 374
117 3300006163 Ga0070715_10000019 Ga0070715_1000001950 374
118 3300006173 Ga0070716_100000004 Ga0070716_10000000499 374
119 3300006931 Ga0097620_100200702 Ga0097620_1002007022 374
120 3300009098 Ga0105245_10139505 Ga0105245_101395051 374
121 3300009148 Ga0105243_10001709 Ga0105243_100017093 374
122 3300009148 Ga0105243_10004957 Ga0105243_100049576 374
123 3300009176 Ga0105242_10000301 Ga0105242_100003013 374
124 3300009176 Ga0105242_10000554 Ga0105242_100005544 374
125 3300009176 Ga0105242_10008643 Ga0105242_100086434 374
126 3300009176 Ga0105242_10091148 Ga0105242_100911482 374
127 3300009177 Ga0105248_10042494 Ga0105248_100424943 374
128 3300013297 Ga0157378_10000003 Ga0157378_1000000314 374
129 3300013297 Ga0157378_10182571 Ga0157378_101825712 374
130 3300013308 Ga0157375_10001002 Ga0157375_1000100210 374
131 3300013308 Ga0157375_10151629 Ga0157375_101516291 374
132 3300013308 Ga0157375_10369182 Ga0157375_103691821 374
133 3300025223 Ga0207672_1000654 Ga0207672_10006542 374
134 3300025905 Ga0207685_10000021 Ga0207685_1000002170 374
135 3300025910 Ga0207684_10001316 Ga0207684_1000131614 374
136 3300025918 Ga0207662_10003961 Ga0207662_100039612 374
137 3300025922 Ga0207646_10014087 Ga0207646_100140876 374
138 3300025931 Ga0207644_10009353 Ga0207644_100093533 374
139 3300025934 Ga0207686_10000018 Ga0207686_1000001877 374
140 3300025934 Ga0207686_10000021 Ga0207686_10000021113 374
141 3300025935 Ga0207709_10000069 Ga0207709_1000006938 374
142 3300025939 Ga0207665_10000006 Ga0207665_10000006114 374
143 3300025941 Ga0207711_10112367 Ga0207711_101123672 374
144 3300025960 Ga0207651_10054306 Ga0207651_100543062 374
145 3300026023 Ga0207677_10028822 Ga0207677_100288223 374
146 3300026035 Ga0207703_10129063 Ga0207703_101290632 374
147 3300026089 Ga0207648_10107913 Ga0207648_101079131 374
148 3300026118 Ga0207675_100013859 Ga0207675_1000138596 374
149 3300028381 Ga0268264_10022412 Ga0268264_100224122 374
150 3300028381 Ga0268264_10113221 Ga0268264_101132212 374
151 3300039437 Ga0436365_1637931 Ga0436365_1637931_6214_7353 374
152 3300044673 Ga0453683_0137994 Ga0453683_0137994_302_1432 374
153 3300046537 Ga0495598_0013594 Ga0495598_0013594_37_1191 374
154 3300048909 Ga0496106_0001064 Ga0496106_0001064_18336_19493 374
155 3300048917 Ga0496114_0286914 Ga0496114_0286914_64_1218 374
156 3300000546 LJNas_1000551 LJNas_10005516 375
157 3300002074 JGI24748J21848_1000010 JGI24748J21848_100001078 375
158 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001604 375
159 3300005444 Ga0070694_100001151 Ga0070694_10000115112 375
160 3300005444 Ga0070694_100027397 Ga0070694_1000273974 375
161 3300005467 Ga0070706_100050883 Ga0070706_1000508833 375
162 3300005467 Ga0070706_100091780 Ga0070706_1000917802 375
163 3300005468 Ga0070707_100014454 Ga0070707_1000144549 375
164 3300005471 Ga0070698_100038071 Ga0070698_1000380712 375
165 3300005536 Ga0070697_100102888 Ga0070697_1001028882 375
166 3300005549 Ga0070704_100010945 Ga0070704_1000109453 375
167 3300005842 Ga0068858_100000005 Ga0068858_100000005135 375
168 3300006871 Ga0075434_100003175 Ga0075434_1000031756 375
169 3300006914 Ga0075436_100000042 Ga0075436_10000004260 375
170 3300007076 Ga0075435_100018399 Ga0075435_1000183992 375
171 3300009101 Ga0105247_10000002 Ga0105247_10000002391 375
172 3300009101 Ga0105247_10114890 Ga0105247_101148902 375
173 3300009147 Ga0114129_10006111 Ga0114129_1000611113 375
174 3300013297 Ga0157378_10014437 Ga0157378_100144372 375
175 3300014745 Ga0157377_10127007 Ga0157377_101270072 375
176 3300025900 Ga0207710_10000002 Ga0207710_10000002391 375
177 3300025922 Ga0207646_10010517 Ga0207646_100105174 375
178 3300025927 Ga0207687_10109098 Ga0207687_101090981 375
179 3300026035 Ga0207703_10000150 Ga0207703_1000015033 375
180 3300028794 Ga0307515_10252061 Ga0307515_102520611 375
181 3300044673 Ga0453683_0085140 Ga0453683_0085140_557_1732 375
182 3300050513 nmdc:mga0rr50_151_c1 nmdc:mga0rr50_151_c1_7569_8753 375
183 3300050513 nmdc:mga0rr50_55181_c1 nmdc:mga0rr50_55181_c1_1289_2425 375
184 3300050514 nmdc:mga08x19_61_c1 nmdc:mga08x19_61_c1_7566_8750 375

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

231

343

0.96

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

132

433

0.93

PF04389

Peptidase_M28

Peptidase family M28

117

223

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uoi-assembly1.cif.gz_A-2 crystallographic structure of dape from enterococcus faecium 0.8828 2 375
7uoi-assembly1.cif.gz_A-2 crystallographic structure of dape from enterococcus faecium 0.8783 2 375
7rsf-assembly1.cif.gz_B acetylornithine deacetylase from escherichia coli 0.874 4 373
7rsf-assembly1.cif.gz_B acetylornithine deacetylase from escherichia coli 0.861 4 373
7lgp-assembly1.cif.gz_A dape enzyme from shigella flexneri 0.8038 3 372
ID Description Score Start End Superfamily
af_Q4CR09_181_288_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9326 175 276 3.30.70.360
af_P23908_180_301_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9127 174 293 3.30.70.360
af_A4I6W2_9_95_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.909 175 257 3.30.70.360
af_Q57899_200_304_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9046 178 276 3.30.70.360
af_P23908_180_301_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8916 174 293 3.30.70.360
ID Description Score Start End GO Terms
AF-A0A2W5VRV3-F1-model_v4 Acetylornithine deacetylase 0.9584 2 373 GO:0005737
GO:0006526
GO:0008777
GO:0009014
GO:0046872
AF-A0A0D7DXQ1-F1-model_v4 Acetylornithine deacetylase (EC 3.5.1.16) 0.9465 165 372 GO:0006526
GO:0008777
GO:0046872
AF-A0A2W5VRV3-F1-model_v4 Acetylornithine deacetylase 0.9434 2 373 GO:0005737
GO:0006526
GO:0008777
GO:0009014
GO:0046872
AF-K5XD26-F1-model_v4 deleted 0.9425 160 372
AF-A0A7W0MHT6-F1-model_v4 Acetylornithine deacetylase (EC 3.5.1.16) 0.9363 3 299 GO:0005737
GO:0006526
GO:0008777

Feature Viewer

pLDDT pTM Quality
94.42 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map