F282561

General Info

Members Datasets Scaffolds Average Seq Length
184 74 368 71

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_11578946|Ga0157369_115789461
Length 85
Sequence MAKDEEFRTGDHVSWNSHGGTAEGEVEKKITEDTEAAGRTVRASKDDPQYLVKSEKSGGEAVHKPSALHKDGPGRTHRTGRAGAR

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
13 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
14 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
15 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
16 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
17 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
18 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
19 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
20 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
21 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
22 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
23 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
25 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
34 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
35 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
36 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
37 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
38 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
39 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
40 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
41 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
42 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
43 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
44 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
45 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
46 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
47 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
48 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
49 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
50 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
51 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
52 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
53 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
54 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
55 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
56 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
57 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
58 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
59 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
62 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
63 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
66 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
67 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
68 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
69 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
70 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
71 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
72 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
73 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
74 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 1.09
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.63
Nodule 0
Rhizoplane 3.26
Rhizosphere 92.39
Stem 0
Stem Tuber 0
Unclassified 3.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_11578946 3300013105 Bacteria 667
2 Ga0070658_11810649 3300005327 Bacteria 528
3 Ga0070683_100336193 3300005329 Bacteria 1438
4 Ga0070682_101799888 3300005337 Bacteria 534
5 Ga0070674_101867131 3300005356 Bacteria 545
6 Ga0070659_100647468 3300005366 Bacteria 911
7 Ga0070714_100558653 3300005435 Bacteria 1096
8 Ga0070714_102182886 3300005435 Bacteria 539
9 Ga0070713_101518349 3300005436 Unclassified 650
10 Ga0068856_100145122 3300005614 Bacteria 2381
11 Ga0068852_100019496 3300005616 Bacteria 5370
12 Ga0081455_10160299 3300005937 Bacteria 1725
13 Ga0075370_10013176 3300006353 Bacteria 4389
14 Ga0105237_11304607 3300009545 Bacteria 732
15 Ga0105238_10233662 3300009551 Bacteria 1815
16 Ga0105238_10866047 3300009551 Bacteria 921
17 Ga0105035_100247 3300009988 Bacteria 3568
18 Ga0105239_12828885 3300010375 Bacteria 566
19 Ga0105246_12354799 3300011119 Bacteria 521
20 Ga0157371_11585035 3300013102 Bacteria 512
21 Ga0157369_10694563 3300013105 Unclassified 1048
22 Ga0157369_11815714 3300013105 Bacteria 619
23 Ga0157372_10051733 3300013307 Bacteria 4572
24 Ga0157372_13077866 3300013307 Bacteria 533
25 Ga0163163_11411828 3300014325 Bacteria 758
26 Ga0157380_12827006 3300014326 Bacteria 552
27 Ga0206354_10352726 3300020081 Bacteria 504
28 Ga0206353_11086881 3300020082 Bacteria 544
29 Ga0213875_10035852 3300021388 Bacteria 2340
30 Ga0207694_10953460 3300025924 Bacteria 726
31 Ga0207687_10526871 3300025927 Bacteria 989
32 Ga0207664_10639885 3300025929 Bacteria 956
33 Ga0207661_10357079 3300025944 Bacteria 1320
34 Ga0207678_10456026 3300026067 Bacteria 1112
35 Ga0207678_11756427 3300026067 Bacteria 544
36 Ga0207702_10210989 3300026078 Bacteria 1805
37 Ga0207698_10364646 3300026142 Bacteria 1369
38 Ga0207698_10915483 3300026142 Bacteria 885
39 Ga0268266_10105092 3300028379 Bacteria 2494
40 Ga0307408_102494874 3300031548 Bacteria 503
41 Ga0307405_11404328 3300031731 Bacteria 611
42 Ga0307413_10508362 3300031824 Bacteria 969
43 Ga0326468_10087256 3300031889 Bacteria 551
44 Ga0307409_101109019 3300031995 Bacteria 813
45 Ga0307409_101741837 3300031995 Bacteria 652
46 Ga0307414_10352429 3300032004 Bacteria 1264
47 Ga0307415_102405972 3300032126 Bacteria 518
48 Ga0395899_0000832 3300037312 Bacteria 29802
49 Ga0395899_0207821 3300037312 Bacteria 1362
50 Ga0395900_0158170 3300037418 Bacteria 2313
51 Ga0395898_0194857 3300037466 Bacteria 1936
52 Ga0436364_0018301 3300037853 Bacteria 2691
53 Ga0436364_0457663 3300037853 Bacteria 2691
54 Ga0436363_1385996 3300039450 Bacteria 1192
55 Ga0451787_146331 3300041441 Bacteria 755
56 Ga0451791_0873335 3300041451 Bacteria 1175
57 Ga0451793_0928640 3300041452 Bacteria 688
58 Ga0451841_1032794 3300041498 Bacteria 1199
59 Ga0439448_0307979 3300042005 Bacteria 563
60 Ga0466969_0163150 3300044656 Bacteria 1024
61 Ga0466969_0421075 3300044656 Bacteria 607
62 Ga0466969_0516393 3300044656 Bacteria 546
63 Ga0466972_0034244 3300044658 Bacteria 2489
64 Ga0466972_0106287 3300044658 Bacteria 1327
65 Ga0466972_0604116 3300044658 Bacteria 519
66 Ga0466965_0050062 3300044683 Bacteria 2071
67 Ga0466965_0052405 3300044683 Bacteria 2027
68 Ga0466965_0087578 3300044683 Bacteria 1580
69 Ga0466965_0092069 3300044683 Bacteria 1543
70 Ga0466965_0122362 3300044683 Bacteria 1345
71 Ga0466965_0331979 3300044683 Bacteria 830
72 Ga0466966_0184076 3300044684 Bacteria 1267
73 Ga0466966_0505410 3300044684 Bacteria 727
74 Ga0466966_0848642 3300044684 Bacteria 551
75 Ga0466966_0953733 3300044684 Bacteria 517
76 Ga0466961_0061529 3300044693 Bacteria 2386
77 Ga0466961_0067909 3300044693 Bacteria 2264
78 Ga0466961_0074902 3300044693 Bacteria 2146
79 Ga0466961_0160433 3300044693 Bacteria 1402
80 Ga0466961_0345286 3300044693 Bacteria 906
81 Ga0466961_0452559 3300044693 Bacteria 777
82 Ga0466961_0946691 3300044693 Bacteria 512
83 Ga0466961_0955828 3300044693 Bacteria 509
84 Ga0466963_0033497 3300044694 Bacteria 3336
85 Ga0466963_0034960 3300044694 Bacteria 3272
86 Ga0466963_0051022 3300044694 Bacteria 2741
87 Ga0466963_0137633 3300044694 Bacteria 1690
88 Ga0466963_0140121 3300044694 Bacteria 1675
89 Ga0466963_0317389 3300044694 Bacteria 1096
90 Ga0466963_0333689 3300044694 Bacteria 1067
91 Ga0466963_0360233 3300044694 Bacteria 1024
92 Ga0466963_0624552 3300044694 Bacteria 761
93 Ga0466964_0019964 3300044706 Bacteria 2578
94 Ga0466964_0029171 3300044706 Bacteria 2177
95 Ga0466964_0292103 3300044706 Bacteria 819
96 Ga0466964_0416631 3300044706 Bacteria 705
97 Ga0466964_0898316 3300044706 Bacteria 507
98 Ga0466971_0012737 3300044719 Bacteria 3688
99 Ga0466971_0016560 3300044719 Bacteria 3255
100 Ga0466971_0074661 3300044719 Bacteria 1542
101 Ga0466971_0089313 3300044719 Bacteria 1410
102 Ga0466971_0365707 3300044719 Bacteria 699
103 Ga0466971_0584381 3300044719 Bacteria 556
104 Ga0466971_0672524 3300044719 Bacteria 519
105 Ga0466968_0045494 3300044735 Bacteria 1862
106 Ga0466968_0512934 3300044735 Bacteria 598
107 Ga0466970_0031797 3300044765 Bacteria 2787
108 Ga0466970_0033445 3300044765 Bacteria 2718
109 Ga0466970_0082513 3300044765 Bacteria 1739
110 Ga0466970_0525982 3300044765 Bacteria 682
111 Ga0466970_0550299 3300044765 Bacteria 667
112 Ga0466970_0573119 3300044765 Bacteria 653
113 Ga0466957_0015721 3300044842 Bacteria 4421
114 Ga0466957_0035752 3300044842 Bacteria 2982
115 Ga0466957_0087329 3300044842 Bacteria 1950
116 Ga0466957_0197477 3300044842 Bacteria 1320
117 Ga0466957_0236490 3300044842 Bacteria 1211
118 Ga0466957_0317966 3300044842 Bacteria 1050
119 Ga0466957_0480478 3300044842 Bacteria 859
120 Ga0466957_0490983 3300044842 Bacteria 850
121 Ga0466957_0533166 3300044842 Bacteria 817
122 Ga0466957_0794766 3300044842 Unclassified 672
123 Ga0466957_0954456 3300044842 Unclassified 614
124 Ga0466957_0957432 3300044842 Bacteria 613
125 Ga0466957_1004407 3300044842 Bacteria 599
126 Ga0466957_1133729 3300044842 Bacteria 564
127 Ga0466957_1184301 3300044842 Bacteria 552
128 Ga0466960_0000186 3300044901 Bacteria 21341
129 Ga0466960_0011781 3300044901 Bacteria 3672
130 Ga0466960_0034797 3300044901 Bacteria 2350
131 Ga0466960_0074183 3300044901 Bacteria 1700
132 Ga0466960_0100837 3300044901 Bacteria 1486
133 Ga0466960_0145447 3300044901 Bacteria 1262
134 Ga0466960_0196166 3300044901 Bacteria 1101
135 Ga0466960_0251207 3300044901 Bacteria 982
136 Ga0466960_0373432 3300044901 Bacteria 817
137 Ga0466960_0388654 3300044901 Bacteria 802
138 Ga0466960_0388866 3300044901 Bacteria 801
139 Ga0466960_0870352 3300044901 Bacteria 548
140 Ga0466960_0935378 3300044901 Unclassified 530
141 Ga0466959_0085991 3300045049 Bacteria 2262
142 Ga0466959_0197967 3300045049 Bacteria 1400
143 Ga0466959_0446583 3300045049 Bacteria 877
144 Ga0466959_0685573 3300045049 Bacteria 687
145 Ga0466959_0768976 3300045049 Bacteria 644
146 Ga0466959_1041510 3300045049 Bacteria 545
147 Ga0466958_0032539 3300045836 Bacteria 3103
148 Ga0466958_0089201 3300045836 Bacteria 1906
149 Ga0466958_0128430 3300045836 Bacteria 1590
150 Ga0466958_0255407 3300045836 Bacteria 1122
151 Ga0466958_0289750 3300045836 Bacteria 1050
152 Ga0466958_0305413 3300045836 Bacteria 1022
153 Ga0466958_0313066 3300045836 Bacteria 1008
154 Ga0466958_0655390 3300045836 Bacteria 683
155 Ga0466967_0018082 3300045976 Bacteria 5623
156 Ga0466967_0053281 3300045976 Bacteria 3555
157 Ga0466967_0054720 3300045976 Bacteria 3514
158 Ga0466967_0065039 3300045976 Bacteria 3245
159 Ga0466967_0066682 3300045976 Bacteria 3208
160 Ga0466967_0145405 3300045976 Bacteria 2211
161 Ga0466967_0351684 3300045976 Bacteria 1426
162 Ga0466967_0583153 3300045976 Bacteria 1102
163 Ga0466967_0961877 3300045976 Unclassified 850
164 Ga0466967_1094967 3300045976 Bacteria 794
165 Ga0466967_1444629 3300045976 Bacteria 685
166 Ga0466967_1530324 3300045976 Bacteria 664
167 Ga0466967_1760686 3300045976 Bacteria 617
168 Ga0466967_1782733 3300045976 Bacteria 613
169 Ga0466967_1802472 3300045976 Bacteria 609
170 Ga0466967_1877112 3300045976 Bacteria 596
171 Ga0495665_0033710 3300046531 Bacteria 2738
172 Ga0495588_0430640 3300046674 Bacteria 692
173 Ga0495581_0040299 3300047315 Bacteria 2703
174 Ga0496108_0623309 3300048911 Bacteria 939
175 Ga0496112_1595764 3300048915 Bacteria 566
176 Ga0496113_0217374 3300048916 Bacteria 1523
177 nmdc:mga07m45_28893_c1 3300050496 Bacteria 3062
178 nmdc:mga0sz30_446514_c1 3300050516 Bacteria 580
179 Ga0466962_0023239 3300061719 Bacteria 2980
180 Ga0466962_0056759 3300061719 Bacteria 1870
181 Ga0466962_0069306 3300061719 Bacteria 1684
182 Ga0466962_0325197 3300061719 Bacteria 763
183 Ga0466962_0726460 3300061719 Bacteria 510
184 2862993556 2862993130 Bacteria 3860849
185 Ga0157369_11578946
186 Ga0070658_11810649
187 Ga0070683_100336193
188 Ga0070682_101799888
189 Ga0070674_101867131
190 Ga0070659_100647468
191 Ga0070714_100558653
192 Ga0070714_102182886
193 Ga0070713_101518349
194 Ga0068856_100145122
195 Ga0068852_100019496
196 Ga0081455_10160299
197 Ga0075370_10013176
198 Ga0105237_11304607
199 Ga0105238_10233662
200 Ga0105238_10866047
201 Ga0105035_100247
202 Ga0105239_12828885
203 Ga0105246_12354799
204 Ga0157371_11585035
205 Ga0157369_10694563
206 Ga0157369_11815714
207 Ga0157372_10051733
208 Ga0157372_13077866
209 Ga0163163_11411828
210 Ga0157380_12827006
211 Ga0206354_10352726
212 Ga0206353_11086881
213 Ga0213875_10035852
214 Ga0207694_10953460
215 Ga0207687_10526871
216 Ga0207664_10639885
217 Ga0207661_10357079
218 Ga0207678_10456026
219 Ga0207678_11756427
220 Ga0207702_10210989
221 Ga0207698_10364646
222 Ga0207698_10915483
223 Ga0268266_10105092
224 Ga0307408_102494874
225 Ga0307405_11404328
226 Ga0307413_10508362
227 Ga0326468_10087256
228 Ga0307409_101109019
229 Ga0307409_101741837
230 Ga0307414_10352429
231 Ga0307415_102405972
232 Ga0395899_0000832
233 Ga0395899_0207821
234 Ga0395900_0158170
235 Ga0395898_0194857
236 Ga0436364_0018301
237 Ga0436364_0457663
238 Ga0436363_1385996
239 Ga0451787_146331
240 Ga0451791_0873335
241 Ga0451793_0928640
242 Ga0451841_1032794
243 Ga0439448_0307979
244 Ga0466969_0163150
245 Ga0466969_0421075
246 Ga0466969_0516393
247 Ga0466972_0034244
248 Ga0466972_0106287
249 Ga0466972_0604116
250 Ga0466965_0050062
251 Ga0466965_0052405
252 Ga0466965_0087578
253 Ga0466965_0092069
254 Ga0466965_0122362
255 Ga0466965_0331979
256 Ga0466966_0184076
257 Ga0466966_0505410
258 Ga0466966_0848642
259 Ga0466966_0953733
260 Ga0466961_0061529
261 Ga0466961_0067909
262 Ga0466961_0074902
263 Ga0466961_0160433
264 Ga0466961_0345286
265 Ga0466961_0452559
266 Ga0466961_0946691
267 Ga0466961_0955828
268 Ga0466963_0033497
269 Ga0466963_0034960
270 Ga0466963_0051022
271 Ga0466963_0137633
272 Ga0466963_0140121
273 Ga0466963_0317389
274 Ga0466963_0333689
275 Ga0466963_0360233
276 Ga0466963_0624552
277 Ga0466964_0019964
278 Ga0466964_0029171
279 Ga0466964_0292103
280 Ga0466964_0416631
281 Ga0466964_0898316
282 Ga0466971_0012737
283 Ga0466971_0016560
284 Ga0466971_0074661
285 Ga0466971_0089313
286 Ga0466971_0365707
287 Ga0466971_0584381
288 Ga0466971_0672524
289 Ga0466968_0045494
290 Ga0466968_0512934
291 Ga0466970_0031797
292 Ga0466970_0033445
293 Ga0466970_0082513
294 Ga0466970_0525982
295 Ga0466970_0550299
296 Ga0466970_0573119
297 Ga0466957_0015721
298 Ga0466957_0035752
299 Ga0466957_0087329
300 Ga0466957_0197477
301 Ga0466957_0236490
302 Ga0466957_0317966
303 Ga0466957_0480478
304 Ga0466957_0490983
305 Ga0466957_0533166
306 Ga0466957_0794766
307 Ga0466957_0954456
308 Ga0466957_0957432
309 Ga0466957_1004407
310 Ga0466957_1133729
311 Ga0466957_1184301
312 Ga0466960_0000186
313 Ga0466960_0011781
314 Ga0466960_0034797
315 Ga0466960_0074183
316 Ga0466960_0100837
317 Ga0466960_0145447
318 Ga0466960_0196166
319 Ga0466960_0251207
320 Ga0466960_0373432
321 Ga0466960_0388654
322 Ga0466960_0388866
323 Ga0466960_0870352
324 Ga0466960_0935378
325 Ga0466959_0085991
326 Ga0466959_0197967
327 Ga0466959_0446583
328 Ga0466959_0685573
329 Ga0466959_0768976
330 Ga0466959_1041510
331 Ga0466958_0032539
332 Ga0466958_0089201
333 Ga0466958_0128430
334 Ga0466958_0255407
335 Ga0466958_0289750
336 Ga0466958_0305413
337 Ga0466958_0313066
338 Ga0466958_0655390
339 Ga0466967_0018082
340 Ga0466967_0053281
341 Ga0466967_0054720
342 Ga0466967_0065039
343 Ga0466967_0066682
344 Ga0466967_0145405
345 Ga0466967_0351684
346 Ga0466967_0583153
347 Ga0466967_0961877
348 Ga0466967_1094967
349 Ga0466967_1444629
350 Ga0466967_1530324
351 Ga0466967_1760686
352 Ga0466967_1782733
353 Ga0466967_1802472
354 Ga0466967_1877112
355 Ga0495665_0033710
356 Ga0495588_0430640
357 Ga0495581_0040299
358 Ga0496108_0623309
359 Ga0496112_1595764
360 Ga0496113_0217374
361 nmdc:mga07m45_28893_c1
362 nmdc:mga0sz30_446514_c1
363 Ga0466962_0023239
364 Ga0466962_0056759
365 Ga0466962_0069306
366 Ga0466962_0325197
367 Ga0466962_0726460
368 2862993556

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11160

Hva1_TUDOR

Hypervirulence associated proteins TUDOR domain

10

68

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kco-assembly5.cif.gz_J shuguo pwwp in complex with ssdna 0.838 3 70
6ie7-assembly3.cif.gz_C crystal structure of adcp1 tandem agenet domain 1-2 in complex with h3k9me2 0.8277 3 67
6kco-assembly1.cif.gz_A shuguo pwwp in complex with ssdna 0.8209 3 70
6hq9-assembly2.cif.gz_B crystal structure of the tudor domain of human ercc6-l2 0.8178 1 70
5vy1-assembly2.cif.gz_B crystal structure of the extended tudor domain from bmpapi 0.8173 4 70
ID Description Score Start End Superfamily
af_Q9ZVT1_72_152_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8682 3 69 2.30.30.140
af_P61407_495_668_2.40.50.90 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8436 4 67 2.40.50.90
af_Q9VWS8_303_353_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8404 3 67 2.30.30.140
af_Q1L8U8_566_624_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8264 1 67 2.30.30.140
af_C4JC55_232_296_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8236 3 69 2.30.30.140
ID Description Score Start End GO Terms
AF-A0A537ZQT6-F1-model_v4 DUF2945 domain-containing protein 0.9911 1 70
AF-A0A7U6GT86-F1-model_v4 deleted 0.9883 4 70
AF-A0A7J9WTP1-F1-model_v4 DUF2945 domain-containing protein 0.988 1 70
AF-A0A1R0KZ91-F1-model_v4 Hypervirulence associated protein TUDOR domain-containing protein 0.986 1 69
AF-A0A653Q953-F1-model_v4 Hypervirulence associated protein TUDOR domain-containing protein 0.9833 6 70

Map