F281169

General Info

Members Datasets Scaffolds Average Seq Length
183 172 366 160

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0753021|Ga0373925_0753021_166_705
Length 179
Sequence VAAPSARDVGPELTSEAKGQAVATTKNTICLWYDKDAEAAARFYAGTFPDSSVQAVHRAPSDYPSGKAGDVLTVEFTVAGVCLGLNGGPAFSHNEAFSFQIATDDQEETDRYWDAIVGNGGQESACGWCKDKWGVFWQITPRVLTEALAAGGAEAKRAFDAMMEMRKIDVAAIEAARRG

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
37 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
40 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
74 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
75 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
76 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
77 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
78 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
79 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
80 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
81 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
82 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
83 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
84 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
87 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
88 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
89 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
101 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
102 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
103 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
104 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
105 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
106 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
110 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
113 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
117 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
120 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
121 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
124 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
125 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
131 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
152 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
159 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
160 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
161 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
162 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
163 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
164 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
165 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
166 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
167 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
168 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
169 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
170 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
171 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
172 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 92.35
Metatranscriptomes 0
Isolates 7.65

Biome Distribution

Category Percentage (%)
Aerial Root 0.55
Bulb 0
Endosphere 6.56
Nodule 0
Rhizoplane 1.64
Rhizosphere 86.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0753021 3300037068 Bacteria 803
2 JGI25165J46597_1000138 3300003214 Bacteria 121773
3 Ga0055526_1002240 3300003771 Bacteria 13238
4 Ga0055524_1044864 3300003775 Bacteria 1070
5 Ga0055536_1002342 3300003781 Bacteria 10730
6 Ga0055531_10003103 3300003794 Bacteria 10730
7 Ga0065712_10171996 3300005290 Bacteria 1238
8 Ga0070670_100004618 3300005331 Bacteria 11553
9 Ga0068869_101896970 3300005334 Bacteria 534
10 Ga0070680_100763737 3300005336 Bacteria 832
11 Ga0070660_101177676 3300005339 Bacteria 649
12 Ga0070668_100053928 3300005347 Bacteria 3100
13 Ga0070675_100745178 3300005354 Bacteria 894
14 Ga0070675_100899027 3300005354 Bacteria 811
15 Ga0070659_100170092 3300005366 Bacteria 1784
16 Ga0070709_10042111 3300005434 Bacteria 2818
17 Ga0070713_101368404 3300005436 Bacteria 686
18 Ga0070710_10213201 3300005437 Bacteria 1225
19 Ga0070694_100170465 3300005444 Bacteria 1603
20 Ga0070681_10014864 3300005458 Bacteria 7739
21 Ga0070699_100057247 3300005518 Bacteria 3376
22 Ga0070679_100026929 3300005530 Bacteria 5653
23 Ga0070679_100494721 3300005530 Bacteria 1167
24 Ga0068853_100007026 3300005539 Bacteria 8999
25 Ga0070695_100079543 3300005545 Bacteria 2164
26 Ga0070696_100450460 3300005546 Bacteria 1015
27 Ga0068855_100337162 3300005563 Bacteria 1663
28 Ga0081455_10214039 3300005937 Bacteria 1434
29 Ga0075364_10252904 3300006051 Bacteria 1197
30 Ga0105245_10001471 3300009098 Bacteria 21285
31 Ga0105243_10064253 3300009148 Bacteria 2944
32 Ga0105243_10170564 3300009148 Bacteria 1884
33 Ga0105248_10415999 3300009177 Bacteria 1514
34 Ga0099796_10216421 3300010159 Bacteria 783
35 Ga0157370_10004783 3300013104 Bacteria 15402
36 Ga0157370_11217558 3300013104 Bacteria 679
37 Ga0157378_10714338 3300013297 Bacteria 1022
38 Ga0157372_10331935 3300013307 Bacteria 1771
39 Ga0163163_10063841 3300014325 Bacteria 3653
40 Ga0182006_1012771 3300015261 Bacteria 3667
41 Ga0182007_10005760 3300015262 Bacteria 5389
42 Ga0213876_10099921 3300021384 Bacteria 1538
43 Ga0213871_10210703 3300021441 Bacteria 609
44 Ga0209130_1008912 3300025284 Bacteria 2911
45 Ga0209676_1000552 3300025292 Bacteria 57303
46 Ga0209256_1001566 3300025299 Bacteria 22502
47 Ga0209257_1000682 3300025304 Bacteria 52816
48 Ga0207692_10126922 3300025898 Bacteria 1436
49 Ga0207680_10552523 3300025903 Bacteria 822
50 Ga0207705_10024984 3300025909 Bacteria 4264
51 Ga0207707_10720575 3300025912 Bacteria 836
52 Ga0207660_10081825 3300025917 Bacteria 2374
53 Ga0207657_10002765 3300025919 Bacteria 18890
54 Ga0207649_10100005 3300025920 Bacteria 1917
55 Ga0207652_10031845 3300025921 Bacteria 4429
56 Ga0207687_10001257 3300025927 Bacteria 17337
57 Ga0207664_10265096 3300025929 Bacteria 1503
58 Ga0207686_10085605 3300025934 Bacteria 2068
59 Ga0207709_10046912 3300025935 Bacteria 2624
60 Ga0207709_10087571 3300025935 Bacteria 2025
61 Ga0207667_10117859 3300025949 Bacteria 2736
62 Ga0207668_10009002 3300025972 Bacteria 5969
63 Ga0207639_10015252 3300026041 Bacteria 5416
64 Ga0207683_10475034 3300026121 Bacteria 1154
65 Ga0268266_10015199 3300028379 Bacteria 6610
66 Ga0307509_10437978 3300031507 Bacteria 1004
67 Ga0307408_100568321 3300031548 Bacteria 1003
68 Ga0265342_10299205 3300031712 Bacteria 848
69 Ga0307405_11010865 3300031731 Bacteria 710
70 Ga0307413_10268495 3300031824 Bacteria 1276
71 Ga0307406_10451715 3300031901 Bacteria 1031
72 Ga0307412_10604520 3300031911 Bacteria 929
73 Ga0307416_100020415 3300032002 Bacteria 4727
74 Ga0307414_10569915 3300032004 Bacteria 1011
75 Ga0395900_0256412 3300037418 Bacteria 1748
76 Ga0395905_0177638 3300037471 Bacteria 1998
77 Ga0436365_1731778 3300039437 Bacteria 4905
78 Ga0436360_0350560 3300039438 Bacteria 2095
79 Ga0436361_0095907 3300039447 Bacteria 1403
80 Ga0436361_0489030 3300039447 Bacteria 8200
81 Ga0439438_000039 3300041405 Bacteria 66110
82 Ga0439447_009492 3300041407 Bacteria 2943
83 Ga0439466_0039572 3300041411 Bacteria 1579
84 Ga0439431_0000182 3300041997 Bacteria 12184
85 Ga0439432_000290 3300042006 Bacteria 18098
86 Ga0439452_003335 3300042010 Bacteria 5647
87 Ga0450890_037426 3300042127 Bacteria 709
88 Ga0450910_005857 3300042147 Bacteria 1684
89 Ga0439446_0011843 3300042156 Bacteria 2374
90 Ga0439464_0004217 3300042439 Bacteria 3665
91 Ga0466969_0090101 3300044656 Bacteria 1454
92 Ga0466972_0056890 3300044658 Bacteria 1879
93 Ga0466978_0074443 3300044671 Bacteria 2118
94 Ga0466982_0037893 3300044672 Bacteria 2904
95 Ga0453683_0157340 3300044673 Bacteria 1437
96 Ga0466965_0003135 3300044683 Bacteria 7208
97 Ga0466966_0097341 3300044684 Bacteria 1822
98 Ga0466963_0890322 3300044694 Bacteria 627
99 Ga0466971_0299018 3300044719 Bacteria 772
100 Ga0466968_0015774 3300044735 Bacteria 3000
101 Ga0466970_0000019 3300044765 Bacteria 61649
102 Ga0466957_0018503 3300044842 Bacteria 4092
103 Ga0466959_0001658 3300045049 Bacteria 13785
104 Ga0466967_0003092 3300045976 Bacteria 10702
105 Ga0495638_0011096 3300046460 Bacteria 6227
106 Ga0495605_0053077 3300046474 Bacteria 1967
107 Ga0495584_0286059 3300046491 Bacteria 837
108 Ga0495585_0016926 3300046492 Bacteria 4222
109 Ga0495607_0081654 3300046501 Bacteria 1775
110 Ga0495583_0125850 3300046506 Bacteria 1075
111 Ga0495616_0042888 3300046513 Bacteria 2300
112 Ga0495631_0133073 3300046518 Bacteria 1068
113 Ga0495631_0274014 3300046518 Bacteria 719
114 Ga0495632_0004344 3300046519 Bacteria 9656
115 Ga0495643_0216986 3300046522 Bacteria 909
116 Ga0495644_0042777 3300046523 Bacteria 1706
117 Ga0495663_0157337 3300046525 Bacteria 778
118 Ga0495642_0064281 3300046528 Bacteria 1526
119 Ga0495609_0006187 3300046538 Bacteria 6154
120 Ga0495621_0192098 3300046539 Bacteria 819
121 Ga0495597_0022622 3300046542 Bacteria 2913
122 Ga0495668_0023210 3300046616 Bacteria 3540
123 Ga0495668_0416294 3300046616 Bacteria 739
124 Ga0495611_0006168 3300046648 Bacteria 5115
125 Ga0495659_0167406 3300046664 Bacteria 890
126 Ga0495658_0522146 3300046683 Bacteria 760
127 Ga0495589_0082741 3300046794 Bacteria 1560
128 Ga0495660_0145791 3300046810 Bacteria 1173
129 Ga0495672_0008015 3300047320 Bacteria 7859
130 Ga0495676_0879227 3300047321 Bacteria 575
131 Ga0495683_0056103 3300047323 Bacteria 1960
132 Ga0495677_0126783 3300047445 Bacteria 975
133 Ga0495681_0130282 3300047470 Bacteria 1071
134 Ga0495686_0046608 3300047472 Bacteria 2739
135 Ga0495686_0272058 3300047472 Bacteria 944
136 Ga0495626_0057324 3300048091 Bacteria 1782
137 Ga0496106_1319888 3300048909 Bacteria 559
138 Ga0496121_0074883 3300048924 Bacteria 2706
139 Ga0495682_0044368 3300049460 Bacteria 1627
140 Ga0501294_001105 3300049517 Bacteria 2817
141 Ga0501032_0322741 3300049569 Bacteria 996
142 Ga0501036_0157830 3300049572 Bacteria 1913
143 Ga0501037_0071161 3300049573 Bacteria 2530
144 Ga0501038_0361993 3300049574 Bacteria 1128
145 Ga0501039_0305524 3300049575 Bacteria 1250
146 Ga0501040_0082089 3300049576 Bacteria 2234
147 Ga0501041_0048179 3300049577 Bacteria 2595
148 Ga0501046_0297894 3300049580 Bacteria 1178
149 Ga0501046_0404300 3300049580 Bacteria 986
150 Ga0501047_1049786 3300049581 Bacteria 628
151 Ga0501048_0027557 3300049582 Bacteria 4128
152 Ga0501067_0515928 3300049583 Bacteria 669
153 Ga0501069_0106173 3300049585 Bacteria 1596
154 Ga0501070_0408544 3300049586 Bacteria 1097
155 Ga0501071_0044783 3300049587 Bacteria 3174
156 Ga0501072_0018774 3300049588 Bacteria 5333
157 Ga0501074_0212115 3300049590 Bacteria 1379
158 Ga0501075_0463679 3300049591 Bacteria 966
159 Ga0501259_073019 3300049688 Bacteria 740
160 Ga0501079_0027213 3300049741 Bacteria 4384
161 Ga0501262_002111 3300049759 Bacteria 2247
162 Ga0501268_028611 3300049765 Bacteria 997
163 Ga0501035_0052171 3300049822 Bacteria 3660
164 Ga0501035_0156810 3300049822 Bacteria 1973
165 Ga0501044_0935486 3300049823 Bacteria 740
166 nmdc:mga00v17_380179_c1 3300050491 Bacteria 918
167 Ga0500589_110044 3300053147 Bacteria 1183
168 Ga0501082_0137888 3300060353 Bacteria 2117
169 Ga0466962_0011562 3300061719 Bacteria 4251
170 2599502061 2599185188 Bacteria 6164180
171 2599932879 2599185300 Bacteria 6062622
172 2644256743 2643221646 Bacteria 6433402
173 2794596884 2791355520 Bacteria 5948615
174 2808854744 2808606361 Bacteria 6136259
175 2808925100 2808606376 Bacteria 6248667
176 2808935061 2808606378 Bacteria 6177535
177 2808947294 2808606380 Bacteria 6248705
178 2808963458 2808606383 Bacteria 6138645
179 2808998137 2808606389 Bacteria 6138126
180 2881929827 2881927736 Bacteria 3993927
181 2939589799 2939589442 Bacteria 4214238
182 2974307648 2974307012 Bacteria 4172388
183 2984517148 2984514374 Bacteria 4172479
184 Ga0373925_0753021
185 JGI25165J46597_1000138
186 Ga0055526_1002240
187 Ga0055524_1044864
188 Ga0055536_1002342
189 Ga0055531_10003103
190 Ga0065712_10171996
191 Ga0070670_100004618
192 Ga0068869_101896970
193 Ga0070680_100763737
194 Ga0070660_101177676
195 Ga0070668_100053928
196 Ga0070675_100745178
197 Ga0070675_100899027
198 Ga0070659_100170092
199 Ga0070709_10042111
200 Ga0070713_101368404
201 Ga0070710_10213201
202 Ga0070694_100170465
203 Ga0070681_10014864
204 Ga0070699_100057247
205 Ga0070679_100026929
206 Ga0070679_100494721
207 Ga0068853_100007026
208 Ga0070695_100079543
209 Ga0070696_100450460
210 Ga0068855_100337162
211 Ga0081455_10214039
212 Ga0075364_10252904
213 Ga0105245_10001471
214 Ga0105243_10064253
215 Ga0105243_10170564
216 Ga0105248_10415999
217 Ga0099796_10216421
218 Ga0157370_10004783
219 Ga0157370_11217558
220 Ga0157378_10714338
221 Ga0157372_10331935
222 Ga0163163_10063841
223 Ga0182006_1012771
224 Ga0182007_10005760
225 Ga0213876_10099921
226 Ga0213871_10210703
227 Ga0209130_1008912
228 Ga0209676_1000552
229 Ga0209256_1001566
230 Ga0209257_1000682
231 Ga0207692_10126922
232 Ga0207680_10552523
233 Ga0207705_10024984
234 Ga0207707_10720575
235 Ga0207660_10081825
236 Ga0207657_10002765
237 Ga0207649_10100005
238 Ga0207652_10031845
239 Ga0207687_10001257
240 Ga0207664_10265096
241 Ga0207686_10085605
242 Ga0207709_10046912
243 Ga0207709_10087571
244 Ga0207667_10117859
245 Ga0207668_10009002
246 Ga0207639_10015252
247 Ga0207683_10475034
248 Ga0268266_10015199
249 Ga0307509_10437978
250 Ga0307408_100568321
251 Ga0265342_10299205
252 Ga0307405_11010865
253 Ga0307413_10268495
254 Ga0307406_10451715
255 Ga0307412_10604520
256 Ga0307416_100020415
257 Ga0307414_10569915
258 Ga0395900_0256412
259 Ga0395905_0177638
260 Ga0436365_1731778
261 Ga0436360_0350560
262 Ga0436361_0095907
263 Ga0436361_0489030
264 Ga0439438_000039
265 Ga0439447_009492
266 Ga0439466_0039572
267 Ga0439431_0000182
268 Ga0439432_000290
269 Ga0439452_003335
270 Ga0450890_037426
271 Ga0450910_005857
272 Ga0439446_0011843
273 Ga0439464_0004217
274 Ga0466969_0090101
275 Ga0466972_0056890
276 Ga0466978_0074443
277 Ga0466982_0037893
278 Ga0453683_0157340
279 Ga0466965_0003135
280 Ga0466966_0097341
281 Ga0466963_0890322
282 Ga0466971_0299018
283 Ga0466968_0015774
284 Ga0466970_0000019
285 Ga0466957_0018503
286 Ga0466959_0001658
287 Ga0466967_0003092
288 Ga0495638_0011096
289 Ga0495605_0053077
290 Ga0495584_0286059
291 Ga0495585_0016926
292 Ga0495607_0081654
293 Ga0495583_0125850
294 Ga0495616_0042888
295 Ga0495631_0133073
296 Ga0495631_0274014
297 Ga0495632_0004344
298 Ga0495643_0216986
299 Ga0495644_0042777
300 Ga0495663_0157337
301 Ga0495642_0064281
302 Ga0495609_0006187
303 Ga0495621_0192098
304 Ga0495597_0022622
305 Ga0495668_0023210
306 Ga0495668_0416294
307 Ga0495611_0006168
308 Ga0495659_0167406
309 Ga0495658_0522146
310 Ga0495589_0082741
311 Ga0495660_0145791
312 Ga0495672_0008015
313 Ga0495676_0879227
314 Ga0495683_0056103
315 Ga0495677_0126783
316 Ga0495681_0130282
317 Ga0495686_0046608
318 Ga0495686_0272058
319 Ga0495626_0057324
320 Ga0496106_1319888
321 Ga0496121_0074883
322 Ga0495682_0044368
323 Ga0501294_001105
324 Ga0501032_0322741
325 Ga0501036_0157830
326 Ga0501037_0071161
327 Ga0501038_0361993
328 Ga0501039_0305524
329 Ga0501040_0082089
330 Ga0501041_0048179
331 Ga0501046_0297894
332 Ga0501046_0404300
333 Ga0501047_1049786
334 Ga0501048_0027557
335 Ga0501067_0515928
336 Ga0501069_0106173
337 Ga0501070_0408544
338 Ga0501071_0044783
339 Ga0501072_0018774
340 Ga0501074_0212115
341 Ga0501075_0463679
342 Ga0501259_073019
343 Ga0501079_0027213
344 Ga0501262_002111
345 Ga0501268_028611
346 Ga0501035_0052171
347 Ga0501035_0156810
348 Ga0501044_0935486
349 nmdc:mga00v17_380179_c1
350 Ga0500589_110044
351 Ga0501082_0137888
352 Ga0466962_0011562
353 2599502061
354 2599932879
355 2644256743
356 2794596884
357 2808854744
358 2808925100
359 2808935061
360 2808947294
361 2808963458
362 2808998137
363 2881929827
364 2939589799
365 2974307648
366 2984517148

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

25

140

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9713 2 156
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9697 2 156
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9584 2 156
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.957 2 156
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9552 2 156
ID Description Score Start End Superfamily
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9654 2 156 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9524 2 156 3.10.180.10
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7736 9 71 3.30.720.100
af_Q8IK86_519_679_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7667 72 98 3.40.50.300
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7449 8 115 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A4Q6GFM2-F1-model_v4 deleted 0.9987 81 158
AF-A0A534H764-F1-model_v4 VOC family protein 0.9938 73 156
AF-A0A7T9DDW6-F1-model_v4 deleted 0.9893 52 157
AF-A0A2M8V7D6-F1-model_v4 deleted 0.9887 51 158
AF-A0A534H6Z1-F1-model_v4 VOC family protein 0.9878 78 161

Map