F279991

General Info

Members Datasets Scaffolds Average Seq Length
182 130 364 452

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2757320392|2757569268
Length 511
Sequence MIRHLLFSTMALAAFSLPPVSSAGAQTSAPEKPAETQADTLAPGRAPAEPAAKKPSLVTTEGVSDFTLANGMQVVVIPDHRAPVVTQMVWYHVGSADEPPGKSGIAHFLEHLMFKGTKTYPAGEFTNKVAAIGGQENAFTSYDYTAYYQQVSPQALEMVMTYEADRMENLVLTDDVVNTERDVVLEERRMRVDGDPGSILAEETNAALFLNSPYRIPVIGWKPEIEKLNTKDALDFYQRFYTPNNATLVISGDVDPQAVLALAEKTYGKIPRRADPGPRIRPQEPEQRTKRTATLNDERVTQPSFRKIWVVPSYENAKPGDAEALDILSEILGGSIRSRLYQELVVKQGIAASAGADYSGDALDDGTFSVYGAPRGTASLDQVEAAVDGEINRIVKDGVTDTELAQARNRFLKSVVFSRDSQAGMARIYGSTLAVGGTVEDIQKWPDRIRAVTKEQVKDVAVRDLVDARSVTSYLLPPAAEPETAKSDGAAQKVVPLKPATVEKGTKGVKQ

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
9 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
10 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
11 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
12 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
13 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
14 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
15 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
16 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
17 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
18 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
21 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
22 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
23 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
24 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
25 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
26 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
27 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
28 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
29 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
30 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
31 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
32 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
33 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
34 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
35 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
36 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
37 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
38 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
39 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
40 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
41 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
42 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
43 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
44 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
45 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
46 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
48 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
49 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
50 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
51 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
52 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
53 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
54 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
55 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
56 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
57 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
58 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
59 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
60 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
61 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
62 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
63 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
65 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
66 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
67 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
68 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
69 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
70 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
71 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
72 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
73 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
74 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
75 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
76 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
77 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
78 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
79 2643221733 Bosea sp. Root381 Isolate Unclassified
80 2643221734 Bosea sp. Root670 Isolate Unclassified
81 2643221736 Bosea sp. Root483D1 Isolate Unclassified
82 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
83 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
84 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
85 2751185800 Brucella pituitosa AA2 Isolate Unclassified
86 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
87 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
88 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
89 2773857925 Microvirga vignae BR3299 Isolate Unclassified
90 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
91 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
92 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
93 2818991467 Bosea vestrisii 3192 Isolate Unclassified
94 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
95 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
96 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
97 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
98 2841760612 Bosea sp. Tri-49 Isolate Nodule
99 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
100 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
101 2842694124 Methylopila sp. R-72369 Isolate Unclassified
102 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
103 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
104 2844104063 Bosea sp. Tri-39 Isolate Nodule
105 2851182111 Bosea sp. Tri-44 Isolate Nodule
106 2851246043 Bosea sp. Tri-54 Isolate Nodule
107 2854911287 Brucella lupini LUP21 Isolate Unclassified
108 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
109 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
110 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
111 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
112 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
113 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
114 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
115 2902330777 Methylobacterium sp. 2A Isolate Unclassified
116 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
117 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
118 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
119 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
120 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
121 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
122 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
123 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
124 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
125 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
126 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
127 641522639 Methylobacterium sp. 4-46 Isolate Nodule
128 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
129 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
130 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 66.48
Metatranscriptomes 0.55
Isolates 32.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.74
Nodule 9.89
Rhizoplane 1.1
Rhizosphere 58.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000018 3300003187 Bacteria 238438
2 Ga0055526_1000243 3300003771 Bacteria 46170
3 Ga0055526_1001130 3300003771 Bacteria 19370
4 Ga0055524_1000048 3300003775 Bacteria 149598
5 Ga0055524_1008940 3300003775 Bacteria 4120
6 Ga0065165_1000337 3300005262 Bacteria 76914
7 Ga0070714_100048492 3300005435 Bacteria 3613
8 Ga0081455_10076871 3300005937 Bacteria 2748
9 Ga0081540_1021172 3300005983 Bacteria 3883
10 Ga0114129_10540200 3300009147 Bacteria 1517
11 Ga0171462_1009 3300013250 Bacteria 344993
12 Ga0157380_10037678 3300014326 Bacteria 3748
13 Ga0209673_1007516 3300025273 Bacteria 5001
14 Ga0209130_1000384 3300025284 Bacteria 49337
15 Ga0209675_1005685 3300025291 Bacteria 5152
16 Ga0209025_1000010 3300025294 Bacteria 986612
17 Ga0209025_1001253 3300025294 Bacteria 35139
18 Ga0209564_1000019 3300025295 Bacteria 573686
19 Ga0209564_1000034 3300025295 Bacteria 444284
20 Ga0209256_1000026 3300025299 Bacteria 432835
21 Ga0209256_1000182 3300025299 Bacteria 122471
22 Ga0207426_1010438 3300025302 Bacteria 3601
23 Ga0209257_1026341 3300025304 Bacteria 1962
24 Ga0207674_10079771 3300026116 Bacteria 3276
25 Ga0265336_10000388 3300028666 Bacteria 27727
26 Ga0265324_10000001 3300029957 Bacteria 562975
27 Ga0265324_10000379 3300029957 Bacteria 32204
28 Ga0265330_10004871 3300031235 Bacteria 6763
29 Ga0265328_10000013 3300031239 Bacteria 156079
30 Ga0265328_10000040 3300031239 Bacteria 91024
31 Ga0265328_10001895 3300031239 Bacteria 9504
32 Ga0265328_10013406 3300031239 Bacteria 3246
33 Ga0265325_10001370 3300031241 Bacteria 17201
34 Ga0265325_10001874 3300031241 Bacteria 14506
35 Ga0265331_10000058 3300031250 Bacteria 175410
36 Ga0265331_10004302 3300031250 Bacteria 8919
37 Ga0265331_10007568 3300031250 Bacteria 6268
38 Ga0265331_10019365 3300031250 Bacteria 3515
39 Ga0265327_10000650 3300031251 Bacteria 56200
40 Ga0265327_10012433 3300031251 Bacteria 5747
41 Ga0265316_10000718 3300031344 Bacteria 36559
42 Ga0265316_10093103 3300031344 Bacteria 2297
43 Ga0265316_10100388 3300031344 Bacteria 2200
44 Ga0307408_100073875 3300031548 Bacteria 2528
45 Ga0265314_10000818 3300031711 Bacteria 37031
46 Ga0265314_10011412 3300031711 Bacteria 7337
47 Ga0265314_10032854 3300031711 Bacteria 3812
48 Ga0307413_10030217 3300031824 Bacteria 3041
49 Ga0307410_10070747 3300031852 Bacteria 2418
50 Ga0307412_10093998 3300031911 Bacteria 2104
51 Ga0307414_10061221 3300032004 Bacteria 2665
52 Ga0395898_0070764 3300037466 Bacteria 3372
53 Ga0451577_0000002 3300042876 Bacteria 1731375
54 Ga0451577_0000962 3300042876 Bacteria 42161
55 Ga0451577_0034159 3300042876 Bacteria 4586
56 Ga0451577_0136489 3300042876 Bacteria 2203
57 Ga0453683_0000011 3300044673 Bacteria 412765
58 Ga0453684_0000002 3300044712 Bacteria 1731375
59 Ga0453684_0000040 3300044712 Bacteria 690210
60 Ga0453684_0034384 3300044712 Bacteria 7035
61 Ga0466968_0001596 3300044735 Bacteria 8179
62 Ga0466970_0055593 3300044765 Bacteria 2114
63 Ga0451576_0000004 3300045051 Bacteria 1312238
64 Ga0451576_0000060 3300045051 Bacteria 290345
65 Ga0451576_0002830 3300045051 Bacteria 24952
66 Ga0451576_0002929 3300045051 Bacteria 24280
67 Ga0451576_0022003 3300045051 Bacteria 6921
68 Ga0451576_0034117 3300045051 Bacteria 5405
69 Ga0495670_0021622 3300046691 Bacteria 3174
70 Ga0496117_0020675 3300048920 Bacteria 5358
71 Ga0496122_0009819 3300048925 Bacteria 9990
72 Ga0496123_0032784 3300048926 Bacteria 3752
73 Ga0496125_0001001 3300048928 Bacteria 44072
74 Ga0501317_000491 3300049533 Bacteria 2811
75 Ga0501033_0003939 3300049570 Bacteria 12043
76 Ga0501036_0021890 3300049572 Bacteria 5375
77 Ga0501037_0000451 3300049573 Bacteria 33602
78 Ga0501037_0072217 3300049573 Bacteria 2510
79 Ga0501038_0063134 3300049574 Bacteria 3163
80 Ga0501043_0000081 3300049579 Bacteria 85059
81 Ga0501043_0034329 3300049579 Bacteria 3990
82 Ga0501047_0005496 3300049581 Bacteria 11927
83 Ga0501047_0013509 3300049581 Bacteria 7741
84 Ga0501047_0162360 3300049581 Bacteria 2106
85 Ga0501069_0000118 3300049585 Bacteria 35026
86 Ga0501069_0029569 3300049585 Bacteria 3007
87 Ga0501069_0076146 3300049585 Bacteria 1886
88 Ga0501070_0002038 3300049586 Bacteria 17765
89 Ga0501070_0002088 3300049586 Bacteria 17529
90 Ga0501070_0050792 3300049586 Bacteria 3441
91 Ga0501071_0043090 3300049587 Bacteria 3235
92 Ga0501071_0114751 3300049587 Bacteria 1993
93 Ga0501073_0051879 3300049589 Bacteria 2873
94 Ga0501073_0098985 3300049589 Bacteria 2025
95 Ga0501074_0000062 3300049590 Bacteria 51831
96 Ga0501238_006719 3300049671 Bacteria 1486
97 Ga0501252_000273 3300049682 Bacteria 3617
98 Ga0501079_0090898 3300049741 Bacteria 2365
99 Ga0501080_0000254 3300049742 Bacteria 40217
100 Ga0501080_0016280 3300049742 Bacteria 6865
101 Ga0501080_0037279 3300049742 Bacteria 4540
102 Ga0501083_0000453 3300049744 Bacteria 26265
103 Ga0501035_0000017 3300049822 Bacteria 241915
104 Ga0501035_0001764 3300049822 Bacteria 21833
105 Ga0501035_0003584 3300049822 Bacteria 14832
106 Ga0501035_0178350 3300049822 Bacteria 1831
107 Ga0501035_0180600 3300049822 Bacteria 1818
108 Ga0501044_0000751 3300049823 Bacteria 39231
109 Ga0501044_0007931 3300049823 Bacteria 11669
110 Ga0501044_0021530 3300049823 Bacteria 6876
111 Ga0501044_0038386 3300049823 Bacteria 5001
112 Ga0501044_0293205 3300049823 Bacteria 1558
113 nmdc:mga00v17_62870_c1 3300050491 Bacteria 2285
114 nmdc:mga05p37_490117_c1 3300050507 Bacteria 1413
115 Ga0500562_000136 3300053108 Bacteria 22146
116 Ga0500593_000075 3300053117 Bacteria 37303
117 Ga0500568_0000002 3300053139 Bacteria 880601
118 Ga0500568_0000048 3300053139 Bacteria 119025
119 Ga0500622_0008858 3300053156 Bacteria 5601
120 Ga0500636_0001838 3300053177 Bacteria 11621
121 Ga0500636_0002933 3300053177 Bacteria 9542
122 Ga0501084_0032037 3300054114 Bacteria 4397
123 2757569268 2757320392 Bacteria 3737298
124 2509079968 2508501114 Bacteria 7082538
125 2511390782 2511231027 Bacteria 5013807
126 2514416657 2513237305 Bacteria 7293571
127 2545672559 2545555834 Bacteria 8130841
128 2545678039 2545555834 Bacteria 8130841
129 2596371326 2595698237 Bacteria 6712432
130 2644728019 2643221733 Bacteria 5690728
131 2644733812 2643221734 Bacteria 5365412
132 2644742298 2643221736 Bacteria 6608466
133 2723571865 2721755686 Bacteria 7343952
134 2738744803 2738541281 Bacteria 5112672
135 2739354033 2738543032 Bacteria 5115625
136 2753357731 2751185800 Bacteria 5467370
137 2758640308 2758568016 Bacteria 5645291
138 2765464387 2765235802 Bacteria 5618596
139 2770194743 2767802442 Bacteria 5747986
140 2774872416 2773857925 Bacteria 6472445
141 2776261829 2775506901 Bacteria 9631051
142 2776272468 2775506902 Bacteria 6208009
143 2776284408 2775506904 Bacteria 5954060
144 2819716898 2818991467 Bacteria 5893227
145 2829747596 2829745981 Bacteria 5406054
146 2835314385 2835312727 Bacteria 7413381
147 2839994298 2839993093 Bacteria 5512535
148 2840769291 2840764183 Bacteria 6358399
149 2841763716 2841760612 Bacteria 6454112
150 2841916814 2841911363 Bacteria 6173697
151 2841917682 2841917233 Bacteria 6173500
152 2842695252 2842694124 Bacteria 4063419
153 2842699822 2842698319 Bacteria 5190321
154 2842873515 2842871566 Bacteria 4827117
155 2844109380 2844104063 Bacteria 6440972
156 2851182972 2851182111 Bacteria 6047226
157 2851251487 2851246043 Bacteria 6439203
158 2854914980 2854911287 Bacteria 5582813
159 2861692308 2861691609 Bacteria 5628931
160 2882457031 2882456835 Bacteria 6863978
161 2884299220 2884298095 Bacteria 3823049
162 2889306457 2889306138 Bacteria 6358934
163 2891089474 2891088606 Bacteria 4762464
164 2894236775 2894232714 Bacteria 8834183
165 2894655325 2894652903 Bacteria 4587256
166 2902332786 2902330777 Bacteria 6395352
167 2902408136 2902405164 Bacteria 6784948
168 2904579027 2904578770 Bacteria 5302906
169 2915654349 2915650412 Bacteria 4288180
170 2917555859 2917554339 Bacteria 4987857
171 2917701588 2917699015 Bacteria 7043791
172 2919122146 2919119836 Bacteria 5208557
173 2928126256 2928125067 Bacteria 5937560
174 2928521916 2928521798 Bacteria 4960112
175 2954014727 2954011201 Bacteria 4762601
176 3002142702 3002141150 Bacteria 5254435
177 3003671908 3003665799 Bacteria 7279786
178 641642444 641522639 Bacteria 7737025
179 641644321 641522639 Bacteria 7737025
180 643598173 643348564 Bacteria 8839022
181 8002061232 8002060224 Bacteria 4026565
182 8057534348 8057529695 Bacteria 6306553
183 JGI25151J46595_10000018
184 Ga0055526_1000243
185 Ga0055526_1001130
186 Ga0055524_1000048
187 Ga0055524_1008940
188 Ga0065165_1000337
189 Ga0070714_100048492
190 Ga0081455_10076871
191 Ga0081540_1021172
192 Ga0114129_10540200
193 Ga0171462_1009
194 Ga0157380_10037678
195 Ga0209673_1007516
196 Ga0209130_1000384
197 Ga0209675_1005685
198 Ga0209025_1000010
199 Ga0209025_1001253
200 Ga0209564_1000019
201 Ga0209564_1000034
202 Ga0209256_1000026
203 Ga0209256_1000182
204 Ga0207426_1010438
205 Ga0209257_1026341
206 Ga0207674_10079771
207 Ga0265336_10000388
208 Ga0265324_10000001
209 Ga0265324_10000379
210 Ga0265330_10004871
211 Ga0265328_10000013
212 Ga0265328_10000040
213 Ga0265328_10001895
214 Ga0265328_10013406
215 Ga0265325_10001370
216 Ga0265325_10001874
217 Ga0265331_10000058
218 Ga0265331_10004302
219 Ga0265331_10007568
220 Ga0265331_10019365
221 Ga0265327_10000650
222 Ga0265327_10012433
223 Ga0265316_10000718
224 Ga0265316_10093103
225 Ga0265316_10100388
226 Ga0307408_100073875
227 Ga0265314_10000818
228 Ga0265314_10011412
229 Ga0265314_10032854
230 Ga0307413_10030217
231 Ga0307410_10070747
232 Ga0307412_10093998
233 Ga0307414_10061221
234 Ga0395898_0070764
235 Ga0451577_0000002
236 Ga0451577_0000962
237 Ga0451577_0034159
238 Ga0451577_0136489
239 Ga0453683_0000011
240 Ga0453684_0000002
241 Ga0453684_0000040
242 Ga0453684_0034384
243 Ga0466968_0001596
244 Ga0466970_0055593
245 Ga0451576_0000004
246 Ga0451576_0000060
247 Ga0451576_0002830
248 Ga0451576_0002929
249 Ga0451576_0022003
250 Ga0451576_0034117
251 Ga0495670_0021622
252 Ga0496117_0020675
253 Ga0496122_0009819
254 Ga0496123_0032784
255 Ga0496125_0001001
256 Ga0501317_000491
257 Ga0501033_0003939
258 Ga0501036_0021890
259 Ga0501037_0000451
260 Ga0501037_0072217
261 Ga0501038_0063134
262 Ga0501043_0000081
263 Ga0501043_0034329
264 Ga0501047_0005496
265 Ga0501047_0013509
266 Ga0501047_0162360
267 Ga0501069_0000118
268 Ga0501069_0029569
269 Ga0501069_0076146
270 Ga0501070_0002038
271 Ga0501070_0002088
272 Ga0501070_0050792
273 Ga0501071_0043090
274 Ga0501071_0114751
275 Ga0501073_0051879
276 Ga0501073_0098985
277 Ga0501074_0000062
278 Ga0501238_006719
279 Ga0501252_000273
280 Ga0501079_0090898
281 Ga0501080_0000254
282 Ga0501080_0016280
283 Ga0501080_0037279
284 Ga0501083_0000453
285 Ga0501035_0000017
286 Ga0501035_0001764
287 Ga0501035_0003584
288 Ga0501035_0178350
289 Ga0501035_0180600
290 Ga0501044_0000751
291 Ga0501044_0007931
292 Ga0501044_0021530
293 Ga0501044_0038386
294 Ga0501044_0293205
295 nmdc:mga00v17_62870_c1
296 nmdc:mga05p37_490117_c1
297 Ga0500562_000136
298 Ga0500593_000075
299 Ga0500568_0000002
300 Ga0500568_0000048
301 Ga0500622_0008858
302 Ga0500636_0001838
303 Ga0500636_0002933
304 Ga0501084_0032037
305 2757569268
306 2509079968
307 2511390782
308 2514416657
309 2545672559
310 2545678039
311 2596371326
312 2644728019
313 2644733812
314 2644742298
315 2723571865
316 2738744803
317 2739354033
318 2753357731
319 2758640308
320 2765464387
321 2770194743
322 2774872416
323 2776261829
324 2776272468
325 2776284408
326 2819716898
327 2829747596
328 2835314385
329 2839994298
330 2840769291
331 2841763716
332 2841916814
333 2841917682
334 2842695252
335 2842699822
336 2842873515
337 2844109380
338 2851182972
339 2851251487
340 2854914980
341 2861692308
342 2882457031
343 2884299220
344 2889306457
345 2891089474
346 2894236775
347 2894655325
348 2902332786
349 2902408136
350 2904579027
351 2915654349
352 2917555859
353 2917701588
354 2919122146
355 2928126256
356 2928521916
357 2954014727
358 3002142702
359 3003671908
360 641642444
361 641644321
362 643598173
363 8002061232
364 8057534348

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05193

Peptidase_M16_C

Peptidase M16 inactive domain

227

411

0.96

PF00675

Peptidase_M16

Insulinase (Peptidase family M16)

73

221

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nnz-assembly2.cif.gz_B subunit pa0372 of heterodimeric zinc protease pa0371-pa0372 0.9577 13 429
4nnz-assembly2.cif.gz_A subunit pa0372 of heterodimeric zinc protease pa0371-pa0372 0.9567 13 429
4nnz-assembly2.cif.gz_B subunit pa0372 of heterodimeric zinc protease pa0371-pa0372 0.9553 13 429
4nnz-assembly2.cif.gz_A subunit pa0372 of heterodimeric zinc protease pa0371-pa0372 0.9544 13 429
3amj-assembly1.cif.gz_C the crystal structure of the heterodimer of m16b peptidase from sphingomonas sp. a1 0.9432 14 429
ID Description Score Start End Superfamily
3amjC01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9814 14 231 3.30.830.10
4nnzB01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9712 13 231 3.30.830.10
4nnzB01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9616 13 231 3.30.830.10
af_A0A0P0V776_44_161_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9565 13 113 3.30.830.10
5eufA01 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9546 12 231 3.30.830.10
ID Description Score Start End GO Terms
AF-A0A7R7YD58-F1-model_v4 Putative zinc protease y4wA 0.9855 10 429 GO:0004222
GO:0006508
GO:0046872
AF-A9MDW3-F1-model_v4 Peptidase M16 domain protein 0.9849 14 428 GO:0004222
GO:0006508
GO:0046872
AF-N0B7K5-F1-model_v4 Peptidase M16 domain-containing protein 0.981 1 429 GO:0004222
GO:0006508
GO:0046872
AF-N0B7K5-F1-model_v4 Peptidase M16 domain-containing protein 0.9787 1 429 GO:0004222
GO:0006508
GO:0046872
AF-A0A6N7A477-F1-model_v4 deleted 0.9768 29 429

Map