F279445

General Info

Members Datasets Scaffolds Average Seq Length
182 107 182 154

Family's Representative Sequence

Representative Sequence 3300035207|Ga0373942_0064037|Ga0373942_0064037_202_774
Length 190
Sequence MTRFLIASVDARVEAKVCLRTSILHEASDLIRLAHPEMKFGIISDTHNYLDPKVPELFVGVDHILHGGDIGMPWLILQLEGIAPVTAVLGNTDDSRLHFKETEVVELDGRKFLVHHIVDPHAPLANAFSPRQARPDVVIFGHTHKPFSQTIDGTLFFNPGYAGKSRFGMARSIAILHSEDGEIRPEYLPL

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
53 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
54 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
55 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
56 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
59 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
68 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
69 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
70 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
78 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
79 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
80 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
81 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
82 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
93 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
94 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
95 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
96 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
97 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
98 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
99 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10172586 3300005295 Bacteria 1473
2 Ga0065707_10516485 3300005295 Bacteria 745
3 Ga0070690_100197948 3300005330 Bacteria 1397
4 Ga0068869_100443839 3300005334 Unclassified 1074
5 Ga0070689_100073185 3300005340 Bacteria 2679
6 Ga0070689_100193342 3300005340 Bacteria 1657
7 Ga0070689_100259345 3300005340 Unclassified 1436
8 Ga0070689_100558377 3300005340 Unclassified 987
9 Ga0070673_100063059 3300005364 Unclassified 2947
10 Ga0070688_100104072 3300005365 Bacteria 1876
11 Ga0070688_100277691 3300005365 Unclassified 1202
12 Ga0070709_10683900 3300005434 Bacteria 797
13 Ga0070709_11105707 3300005434 Unclassified 634
14 Ga0070711_100006155 3300005439 Bacteria 7214
15 Ga0070705_100066077 3300005440 Unclassified 2168
16 Ga0070705_100086106 3300005440 Unclassified 1944
17 Ga0070694_100457783 3300005444 Unclassified 1008
18 Ga0070708_100380461 3300005445 Bacteria 1331
19 Ga0070707_101777766 3300005468 Bacteria 584
20 Ga0070698_100941507 3300005471 Unclassified 810
21 Ga0070699_101539790 3300005518 Unclassified 609
22 Ga0070679_100320112 3300005530 Bacteria 1500
23 Ga0070686_100011043 3300005544 Bacteria 5113
24 Ga0070686_100086901 3300005544 Bacteria 2083
25 Ga0070686_100370942 3300005544 Bacteria 1081
26 Ga0070704_100101049 3300005549 Bacteria 2173
27 Ga0070702_100675016 3300005615 Unclassified 784
28 Ga0068859_100117231 3300005617 Bacteria 2728
29 Ga0068859_100779224 3300005617 Bacteria 1045
30 Ga0068859_103097068 3300005617 Unclassified 507
31 Ga0068864_100284417 3300005618 Bacteria 1544
32 Ga0068864_100887535 3300005618 Unclassified 880
33 Ga0068870_10299980 3300005840 Bacteria 1014
34 Ga0068863_100162479 3300005841 Bacteria 2140
35 Ga0068863_100617683 3300005841 Bacteria 1074
36 Ga0068858_100297872 3300005842 Unclassified 1538
37 Ga0097621_100422807 3300006237 Bacteria 1196
38 Ga0068871_100118733 3300006358 Bacteria 2231
39 Ga0075428_100028515 3300006844 Bacteria 6177
40 Ga0075431_100140007 3300006847 Unclassified 2494
41 Ga0097620_100117232 3300006931 Bacteria 2728
42 Ga0097620_100779230 3300006931 Bacteria 1045
43 Ga0097620_103097000 3300006931 Unclassified 507
44 Ga0099795_10301822 3300007788 Unclassified 704
45 Ga0105240_10014045 3300009093 Bacteria 10953
46 Ga0105240_10062611 3300009093 Bacteria 4631
47 Ga0105240_10233201 3300009093 Bacteria 2138
48 Ga0105240_10788851 3300009093 Unclassified 1030
49 Ga0111539_10027560 3300009094 Bacteria 6939
50 Ga0111539_11100455 3300009094 Unclassified 923
51 Ga0105245_11219055 3300009098 Unclassified 800
52 Ga0105245_12258420 3300009098 Unclassified 598
53 Ga0105245_12828784 3300009098 Unclassified 538
54 Ga0105241_10961269 3300009174 Unclassified 797
55 Ga0105242_10012558 3300009176 Bacteria 6521
56 Ga0105242_10023847 3300009176 Bacteria 4827
57 Ga0105242_10235378 3300009176 Bacteria 1643
58 Ga0105242_10478631 3300009176 Bacteria 1179
59 Ga0105248_10152753 3300009177 Unclassified 2605
60 Ga0105238_10622725 3300009551 Bacteria 1088
61 Ga0105238_10774504 3300009551 Unclassified 974
62 Ga0105238_11425876 3300009551 Bacteria 720
63 Ga0105249_10118799 3300009553 Unclassified 2510
64 Ga0105249_11433951 3300009553 Unclassified 762
65 Ga0105249_12266804 3300009553 Unclassified 616
66 Ga0157374_10524231 3300013296 Unclassified 1191
67 Ga0157374_12044762 3300013296 Unclassified 599
68 Ga0157378_10554987 3300013297 Bacteria 1154
69 Ga0157378_12318872 3300013297 Unclassified 588
70 Ga0163162_10151608 3300013306 Unclassified 2436
71 Ga0163162_11061120 3300013306 Bacteria 917
72 Ga0157375_10000033 3300013308 Bacteria 184526
73 Ga0163163_10046701 3300014325 Unclassified 4254
74 Ga0163163_10680830 3300014325 Unclassified 1092
75 Ga0163163_10862077 3300014325 Bacteria 969
76 Ga0207699_10902390 3300025906 Bacteria 652
77 Ga0207695_10046917 3300025913 Bacteria 4576
78 Ga0207695_10611190 3300025913 Bacteria 971
79 Ga0207663_10004301 3300025916 Bacteria 7068
80 Ga0207646_10838766 3300025922 Bacteria 817
81 Ga0207686_10063911 3300025934 Unclassified 2342
82 Ga0207686_10880462 3300025934 Unclassified 722
83 Ga0207670_10001252 3300025936 Bacteria 13406
84 Ga0207670_10779860 3300025936 Unclassified 795
85 Ga0207712_11081669 3300025961 Unclassified 713
86 Ga0207703_10425956 3300026035 Bacteria 1236
87 Ga0207674_10276336 3300026116 Unclassified 1628
88 Ga0265337_1001014 3300028556 Bacteria 14581
89 Ga0265337_1003132 3300028556 Bacteria 7287
90 Ga0265337_1108195 3300028556 Unclassified 755
91 Ga0265319_1085066 3300028563 Unclassified 1001
92 Ga0265334_10017280 3300028573 Bacteria 2981
93 Ga0265334_10028403 3300028573 Bacteria 2247
94 Ga0265323_10059142 3300028653 Bacteria 1337
95 Ga0265323_10176685 3300028653 Unclassified 677
96 Ga0265336_10119760 3300028666 Bacteria 784
97 Ga0265336_10123846 3300028666 Bacteria 770
98 Ga0265338_10018613 3300028800 Bacteria 7421
99 Ga0265338_10027462 3300028800 Bacteria 5710
100 Ga0265338_10033831 3300028800 Bacteria 4953
101 Ga0265338_10068776 3300028800 Bacteria 3048
102 Ga0265338_10419145 3300028800 Unclassified 952
103 Ga0265338_10446139 3300028800 Bacteria 917
104 Ga0265338_10989168 3300028800 Bacteria 570
105 Ga0265324_10075640 3300029957 Bacteria 1146
106 Ga0265332_10025644 3300031238 Bacteria 2588
107 Ga0265320_10209046 3300031240 Unclassified 870
108 Ga0265340_10258033 3300031247 Unclassified 776
109 Ga0265339_10059026 3300031249 Unclassified 2069
110 Ga0265316_10006339 3300031344 Bacteria 11319
111 Ga0265316_10009515 3300031344 Bacteria 8945
112 Ga0265316_10015158 3300031344 Bacteria 6751
113 Ga0265316_10113342 3300031344 Unclassified 2052
114 Ga0265316_10341632 3300031344 Unclassified 1085
115 Ga0265316_10492544 3300031344 Unclassified 876
116 Ga0265313_10009945 3300031595 Bacteria 6104
117 Ga0265314_10009384 3300031711 Bacteria 8267
118 Ga0265314_10039396 3300031711 Bacteria 3404
119 Ga0265342_10008355 3300031712 Bacteria 7434
120 Ga0316578_10367741 3300031728 Bacteria 855
121 Ga0316577_10129746 3300031733 Unclassified 1419
122 Ga0373942_0064037 3300035207 Bacteria 1060
123 Ga0373931_0270515 3300035691 Bacteria 1040
124 Ga0373937_0178204 3300036401 Unclassified 1996
125 Ga0373937_0685401 3300036401 Unclassified 971
126 Ga0316582_0730623 3300036647 Bacteria 680
127 Ga0451577_0001470 3300042876 Bacteria 31289
128 Ga0451577_0004624 3300042876 Bacteria 14457
129 Ga0451577_0284747 3300042876 Bacteria 1497
130 Ga0453684_0003305 3300044712 Bacteria 36755
131 Ga0453684_0150995 3300044712 Unclassified 2761
132 Ga0453684_0505421 3300044712 Bacteria 1338
133 Ga0451576_0059772 3300045051 Bacteria 3978
134 Ga0451576_0078424 3300045051 Bacteria 3437
135 Ga0451576_0126866 3300045051 Bacteria 2659
136 Ga0451576_0381192 3300045051 Bacteria 1478
137 Ga0451576_1293053 3300045051 Unclassified 760
138 Ga0451576_1431434 3300045051 Unclassified 719
139 Ga0495592_0000052 3300046454 Bacteria 109203
140 Ga0495590_0358426 3300046457 Unclassified 555
141 Ga0495641_0012001 3300046461 Unclassified 4883
142 Ga0495641_0378757 3300046461 Unclassified 641
143 Ga0495580_1068385 3300046472 Unclassified 512
144 Ga0495662_0033169 3300046476 Unclassified 2495
145 Ga0495662_0090228 3300046476 Unclassified 1494
146 Ga0495608_0763191 3300046511 Unclassified 572
147 Ga0495618_0159741 3300046514 Unclassified 1437
148 Ga0495618_0410702 3300046514 Unclassified 827
149 Ga0495628_0007521 3300046516 Bacteria 9426
150 Ga0495630_0163712 3300046517 Unclassified 1693
151 Ga0495630_0393035 3300046517 Unclassified 1062
152 Ga0495652_0042382 3300046529 Unclassified 3925
153 Ga0495640_0062504 3300046533 Unclassified 2525
154 Ga0495640_0411806 3300046533 Unclassified 829
155 Ga0495586_0012170 3300046535 Unclassified 4568
156 Ga0495586_0059014 3300046535 Unclassified 2084
157 Ga0495586_0071088 3300046535 Bacteria 1901
158 Ga0495586_0458199 3300046535 Unclassified 735
159 Ga0495586_0541314 3300046535 Bacteria 672
160 Ga0495645_0181548 3300046543 Unclassified 1441
161 Ga0495667_0142627 3300046559 Bacteria 1543
162 Ga0495634_0040509 3300046642 Bacteria 3168
163 Ga0495634_0458356 3300046642 Unclassified 751
164 Ga0495635_0193006 3300046663 Bacteria 1382
165 Ga0495599_0153657 3300046678 Unclassified 1424
166 Ga0495669_0066544 3300046684 Bacteria 1637
167 Ga0495613_0030103 3300046689 Bacteria 4033
168 Ga0495613_0323142 3300046689 Unclassified 1065
169 Ga0495624_0105046 3300046690 Unclassified 1738
170 Ga0495604_0207696 3300047317 Bacteria 1355
171 Ga0495674_0419107 3300047319 Bacteria 1079
172 Ga0495675_0473299 3300047444 Unclassified 722
173 Ga0501031_0601012 3300049568 Bacteria 708
174 Ga0501034_0275955 3300049571 Bacteria 1621
175 Ga0501039_0725059 3300049575 Bacteria 777
176 Ga0501043_0034959 3300049579 Bacteria 3953
177 Ga0501047_0088489 3300049581 Bacteria 2974
178 Ga0501044_1163794 3300049823 Bacteria 640
179 nmdc:mga06r32_400931_c1 3300050510 Bacteria 1354
180 nmdc:mga08y16_30010_c1 3300050511 Bacteria 5725
181 nmdc:mga08y16_819280_c1 3300050511 Unclassified 922
182 nmdc:mga0a205_1053406_c1 3300050515 Unclassified 660

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046535 Ga0495586_0458199 Ga0495586_0458199_322_717 130
2 3300046472 Ga0495580_1068385 Ga0495580_1068385_45_449 133
3 3300046457 Ga0495590_0358426 Ga0495590_0358426_38_451 137
4 3300049568 Ga0501031_0601012 Ga0501031_0601012_237_692 149
5 3300049823 Ga0501044_1163794 Ga0501044_1163794_13_468 149
6 3300005842 Ga0068858_100297872 Ga0068858_1002978722 152
7 3300006844 Ga0075428_100028515 Ga0075428_1000285152 152
8 3300009094 Ga0111539_10027560 Ga0111539_100275602 152
9 3300013306 Ga0163162_11061120 Ga0163162_110611202 152
10 3300025934 Ga0207686_10880462 Ga0207686_108804622 152
11 3300026035 Ga0207703_10425956 Ga0207703_104259561 152
12 3300035207 Ga0373942_0064037 Ga0373942_0064037_202_774 152
13 3300045051 Ga0451576_0059772 Ga0451576_0059772_1080_1541 152
14 3300050511 nmdc:mga08y16_30010_c1 nmdc:mga08y16_30010_c1_344_802 152
15 3300005330 Ga0070690_100197948 Ga0070690_1001979481 153
16 3300005334 Ga0068869_100443839 Ga0068869_1004438392 153
17 3300005340 Ga0070689_100073185 Ga0070689_1000731852 153
18 3300005340 Ga0070689_100193342 Ga0070689_1001933422 153
19 3300005340 Ga0070689_100259345 Ga0070689_1002593452 153
20 3300005340 Ga0070689_100558377 Ga0070689_1005583772 153
21 3300005365 Ga0070688_100104072 Ga0070688_1001040723 153
22 3300005365 Ga0070688_100277691 Ga0070688_1002776912 153
23 3300005434 Ga0070709_11105707 Ga0070709_111057071 153
24 3300005439 Ga0070711_100006155 Ga0070711_1000061557 153
25 3300005440 Ga0070705_100066077 Ga0070705_1000660772 153
26 3300005440 Ga0070705_100086106 Ga0070705_1000861062 153
27 3300005444 Ga0070694_100457783 Ga0070694_1004577832 153
28 3300005445 Ga0070708_100380461 Ga0070708_1003804612 153
29 3300005468 Ga0070707_101777766 Ga0070707_1017777661 153
30 3300005471 Ga0070698_100941507 Ga0070698_1009415071 153
31 3300005530 Ga0070679_100320112 Ga0070679_1003201122 153
32 3300005544 Ga0070686_100011043 Ga0070686_1000110438 153
33 3300005544 Ga0070686_100370942 Ga0070686_1003709422 153
34 3300005615 Ga0070702_100675016 Ga0070702_1006750162 153
35 3300005617 Ga0068859_100117231 Ga0068859_1001172314 153
36 3300005617 Ga0068859_103097068 Ga0068859_1030970681 153
37 3300005618 Ga0068864_100284417 Ga0068864_1002844171 153
38 3300005841 Ga0068863_100162479 Ga0068863_1001624793 153
39 3300005841 Ga0068863_100617683 Ga0068863_1006176831 153
40 3300006358 Ga0068871_100118733 Ga0068871_1001187332 153
41 3300006847 Ga0075431_100140007 Ga0075431_1001400071 153
42 3300006931 Ga0097620_100117232 Ga0097620_1001172324 153
43 3300006931 Ga0097620_103097000 Ga0097620_1030970001 153
44 3300009093 Ga0105240_10014045 Ga0105240_100140453 153
45 3300009094 Ga0111539_11100455 Ga0111539_111004552 153
46 3300009098 Ga0105245_12258420 Ga0105245_122584201 153
47 3300009174 Ga0105241_10961269 Ga0105241_109612692 153
48 3300009176 Ga0105242_10235378 Ga0105242_102353782 153
49 3300009176 Ga0105242_10478631 Ga0105242_104786312 153
50 3300009551 Ga0105238_10622725 Ga0105238_106227252 153
51 3300009551 Ga0105238_10774504 Ga0105238_107745042 153
52 3300009553 Ga0105249_11433951 Ga0105249_114339512 153
53 3300014325 Ga0163163_10862077 Ga0163163_108620772 153
54 3300025913 Ga0207695_10046917 Ga0207695_100469175 153
55 3300025916 Ga0207663_10004301 Ga0207663_100043012 153
56 3300025922 Ga0207646_10838766 Ga0207646_108387661 153
57 3300025936 Ga0207670_10001252 Ga0207670_100012524 153
58 3300025936 Ga0207670_10779860 Ga0207670_107798601 153
59 3300028556 Ga0265337_1001014 Ga0265337_10010144 153
60 3300028556 Ga0265337_1108195 Ga0265337_11081951 153
61 3300028563 Ga0265319_1085066 Ga0265319_10850661 153
62 3300028573 Ga0265334_10017280 Ga0265334_100172803 153
63 3300028573 Ga0265334_10028403 Ga0265334_100284033 153
64 3300028653 Ga0265323_10059142 Ga0265323_100591422 153
65 3300028653 Ga0265323_10176685 Ga0265323_101766851 153
66 3300028666 Ga0265336_10119760 Ga0265336_101197602 153
67 3300028800 Ga0265338_10018613 Ga0265338_100186138 153
68 3300028800 Ga0265338_10027462 Ga0265338_100274622 153
69 3300028800 Ga0265338_10033831 Ga0265338_100338317 153
70 3300028800 Ga0265338_10068776 Ga0265338_100687762 153
71 3300028800 Ga0265338_10419145 Ga0265338_104191452 153
72 3300028800 Ga0265338_10446139 Ga0265338_104461392 153
73 3300028800 Ga0265338_10989168 Ga0265338_109891681 153
74 3300029957 Ga0265324_10075640 Ga0265324_100756402 153
75 3300031238 Ga0265332_10025644 Ga0265332_100256442 153
76 3300031240 Ga0265320_10209046 Ga0265320_102090461 153
77 3300031247 Ga0265340_10258033 Ga0265340_102580331 153
78 3300031249 Ga0265339_10059026 Ga0265339_100590262 153
79 3300031344 Ga0265316_10006339 Ga0265316_100063396 153
80 3300031344 Ga0265316_10009515 Ga0265316_100095153 153
81 3300031344 Ga0265316_10113342 Ga0265316_101133421 153
82 3300031344 Ga0265316_10341632 Ga0265316_103416321 153
83 3300031344 Ga0265316_10492544 Ga0265316_104925442 153
84 3300031595 Ga0265313_10009945 Ga0265313_100099452 153
85 3300031711 Ga0265314_10009384 Ga0265314_100093846 153
86 3300031711 Ga0265314_10039396 Ga0265314_100393963 153
87 3300031712 Ga0265342_10008355 Ga0265342_100083554 153
88 3300031728 Ga0316578_10367741 Ga0316578_103677411 153
89 3300031733 Ga0316577_10129746 Ga0316577_101297461 153
90 3300036401 Ga0373937_0178204 Ga0373937_0178204_888_1349 153
91 3300036647 Ga0316582_0730623 Ga0316582_0730623_193_657 153
92 3300042876 Ga0451577_0004624 Ga0451577_0004624_2023_2490 153
93 3300042876 Ga0451577_0284747 Ga0451577_0284747_429_896 153
94 3300044712 Ga0453684_0150995 Ga0453684_0150995_698_1165 153
95 3300044712 Ga0453684_0505421 Ga0453684_0505421_13_477 153
96 3300045051 Ga0451576_0126866 Ga0451576_0126866_1511_1984 153
97 3300045051 Ga0451576_0381192 Ga0451576_0381192_146_607 153
98 3300045051 Ga0451576_1431434 Ga0451576_1431434_219_683 153
99 3300046454 Ga0495592_0000052 Ga0495592_0000052_103670_104131 153
100 3300046461 Ga0495641_0012001 Ga0495641_0012001_3586_4050 153
101 3300046461 Ga0495641_0378757 Ga0495641_0378757_71_592 153
102 3300046476 Ga0495662_0033169 Ga0495662_0033169_216_677 153
103 3300046476 Ga0495662_0090228 Ga0495662_0090228_829_1293 153
104 3300046511 Ga0495608_0763191 Ga0495608_0763191_47_511 153
105 3300046514 Ga0495618_0159741 Ga0495618_0159741_526_987 153
106 3300046514 Ga0495618_0410702 Ga0495618_0410702_59_520 153
107 3300046516 Ga0495628_0007521 Ga0495628_0007521_1331_1792 153
108 3300046517 Ga0495630_0163712 Ga0495630_0163712_923_1384 153
109 3300046517 Ga0495630_0393035 Ga0495630_0393035_163_624 153
110 3300046529 Ga0495652_0042382 Ga0495652_0042382_1231_1692 153
111 3300046533 Ga0495640_0062504 Ga0495640_0062504_220_681 153
112 3300046533 Ga0495640_0411806 Ga0495640_0411806_358_819 153
113 3300046535 Ga0495586_0012170 Ga0495586_0012170_1725_2186 153
114 3300046535 Ga0495586_0059014 Ga0495586_0059014_1345_1809 153
115 3300046535 Ga0495586_0071088 Ga0495586_0071088_392_853 153
116 3300046535 Ga0495586_0541314 Ga0495586_0541314_71_535 153
117 3300046543 Ga0495645_0181548 Ga0495645_0181548_380_841 153
118 3300046559 Ga0495667_0142627 Ga0495667_0142627_85_546 153
119 3300046642 Ga0495634_0040509 Ga0495634_0040509_2169_2633 153
120 3300046642 Ga0495634_0458356 Ga0495634_0458356_171_632 153
121 3300046663 Ga0495635_0193006 Ga0495635_0193006_10_477 153
122 3300046689 Ga0495613_0030103 Ga0495613_0030103_1097_1561 153
123 3300046690 Ga0495624_0105046 Ga0495624_0105046_639_1100 153
124 3300047317 Ga0495604_0207696 Ga0495604_0207696_765_1226 153
125 3300047319 Ga0495674_0419107 Ga0495674_0419107_62_523 153
126 3300047444 Ga0495675_0473299 Ga0495675_0473299_35_496 153
127 3300050510 nmdc:mga06r32_400931_c1 nmdc:mga06r32_400931_c1_783_1244 153
128 3300050511 nmdc:mga08y16_819280_c1 nmdc:mga08y16_819280_c1_213_674 153
129 3300005295 Ga0065707_10172586 Ga0065707_101725862 154
130 3300005295 Ga0065707_10516485 Ga0065707_105164852 154
131 3300005364 Ga0070673_100063059 Ga0070673_1000630595 154
132 3300005434 Ga0070709_10683900 Ga0070709_106839001 154
133 3300005518 Ga0070699_101539790 Ga0070699_1015397901 154
134 3300005544 Ga0070686_100086901 Ga0070686_1000869012 154
135 3300005549 Ga0070704_100101049 Ga0070704_1001010492 154
136 3300005617 Ga0068859_100779224 Ga0068859_1007792242 154
137 3300005618 Ga0068864_100887535 Ga0068864_1008875352 154
138 3300005840 Ga0068870_10299980 Ga0068870_102999802 154
139 3300006237 Ga0097621_100422807 Ga0097621_1004228071 154
140 3300006931 Ga0097620_100779230 Ga0097620_1007792302 154
141 3300007788 Ga0099795_10301822 Ga0099795_103018222 154
142 3300009093 Ga0105240_10062611 Ga0105240_100626112 154
143 3300009093 Ga0105240_10233201 Ga0105240_102332012 154
144 3300009093 Ga0105240_10788851 Ga0105240_107888511 154
145 3300009098 Ga0105245_11219055 Ga0105245_112190551 154
146 3300009098 Ga0105245_12828784 Ga0105245_128287841 154
147 3300009176 Ga0105242_10012558 Ga0105242_100125584 154
148 3300009176 Ga0105242_10023847 Ga0105242_100238472 154
149 3300009177 Ga0105248_10152753 Ga0105248_101527532 154
150 3300009551 Ga0105238_11425876 Ga0105238_114258762 154
151 3300009553 Ga0105249_10118799 Ga0105249_101187992 154
152 3300009553 Ga0105249_12266804 Ga0105249_122668041 154
153 3300013296 Ga0157374_10524231 Ga0157374_105242311 154
154 3300013296 Ga0157374_12044762 Ga0157374_120447621 154
155 3300013297 Ga0157378_10554987 Ga0157378_105549872 154
156 3300013297 Ga0157378_12318872 Ga0157378_123188721 154
157 3300013306 Ga0163162_10151608 Ga0163162_101516084 154
158 3300013308 Ga0157375_10000033 Ga0157375_10000033140 154
159 3300014325 Ga0163163_10046701 Ga0163163_100467014 154
160 3300014325 Ga0163163_10680830 Ga0163163_106808302 154
161 3300025906 Ga0207699_10902390 Ga0207699_109023901 154
162 3300025913 Ga0207695_10611190 Ga0207695_106111902 154
163 3300025934 Ga0207686_10063911 Ga0207686_100639113 154
164 3300025961 Ga0207712_11081669 Ga0207712_110816691 154
165 3300026116 Ga0207674_10276336 Ga0207674_102763362 154
166 3300028556 Ga0265337_1003132 Ga0265337_10031327 154
167 3300028666 Ga0265336_10123846 Ga0265336_101238461 154
168 3300031344 Ga0265316_10015158 Ga0265316_100151588 154
169 3300035691 Ga0373931_0270515 Ga0373931_0270515_521_994 154
170 3300036401 Ga0373937_0685401 Ga0373937_0685401_198_668 154
171 3300042876 Ga0451577_0001470 Ga0451577_0001470_26759_27223 154
172 3300044712 Ga0453684_0003305 Ga0453684_0003305_4032_4496 154
173 3300045051 Ga0451576_0078424 Ga0451576_0078424_1910_2383 154
174 3300045051 Ga0451576_1293053 Ga0451576_1293053_241_723 154
175 3300046678 Ga0495599_0153657 Ga0495599_0153657_156_626 154
176 3300046684 Ga0495669_0066544 Ga0495669_0066544_465_947 154
177 3300046689 Ga0495613_0323142 Ga0495613_0323142_135_602 154
178 3300049571 Ga0501034_0275955 Ga0501034_0275955_1014_1493 154
179 3300049575 Ga0501039_0725059 Ga0501039_0725059_259_738 154
180 3300049579 Ga0501043_0034959 Ga0501043_0034959_1380_1859 154
181 3300049581 Ga0501047_0088489 Ga0501047_0088489_16_495 154
182 3300050515 nmdc:mga0a205_1053406_c1 nmdc:mga0a205_1053406_c1_21_488 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

38

181

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s3l-assembly1.cif.gz_A structural and functional characterization of a novel archaeal phosphodiesterase 0.8003 2 154
3ck2-assembly1.cif.gz_A crystal structure of conserved uncharacterized protein (predicted phosphoesterase cog0622) from streptococcus pneumoniae tigr4 0.7948 2 153
1s3l-assembly1.cif.gz_A structural and functional characterization of a novel archaeal phosphodiesterase 0.7908 2 154
5xch-assembly2.cif.gz_B crystal structure of wild type vps29 complexed with zn+2 from entamoeba histolytica 0.7823 2 153
1w24-assembly1.cif.gz_A crystal structure of human vps29 0.7812 2 153
ID Description Score Start End Superfamily
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.834 2 152 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8181 2 154 3.60.21.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8153 2 152 3.60.21.10
af_Q4DWH1_2_191_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8122 2 153 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8086 2 154 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A7C3WA71-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9908 3 154 GO:0016787
GO:0046872
AF-A0A832HTU3-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9818 2 154 GO:0016787
GO:0046872
AF-A0A6N6PUK1-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9786 2 154 GO:0016787
GO:0046872
AF-A0A6N6PUK1-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9723 2 154 GO:0016787
GO:0046872
AF-A0A7C3WA71-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9717 3 154 GO:0016787
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.57 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map