F278588

General Info

Members Datasets Scaffolds Average Seq Length
182 154 182 156

Family's Representative Sequence

Representative Sequence 3300005343|Ga0070687_100449589|Ga0070687_1004495891
Length 169
Sequence MELYRRYGPALLRKAERMLQSREEAQDLVQCLFLDLLQRPRAAGAGAIDLPYLYRAITNRCLNHLRDRRNQGRLIASHELAAQDIARTRVDDQIVDRQILSSLSGRLDDQSWEVLVYRFIDDLGEDEIASLLGASRRTVARRLRRIREEVRLLIAGPRPMAGGRTGEAT

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
65 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
66 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
67 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
70 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
71 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
74 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
85 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
86 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
90 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
91 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
92 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
93 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
95 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
96 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
97 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
115 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
128 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
129 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
130 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
131 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
132 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
133 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
145 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
146 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
147 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
148 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
149 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
150 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
151 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
152 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.95
Nodule 0
Rhizoplane 1.1
Rhizosphere 87.91
Stem 0
Stem Tuber 0
Unclassified 6.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10076483 3300003323 Bacteria 1069
2 Ga0070658_10320198 3300005327 Unclassified 1324
3 Ga0070683_101037916 3300005329 Bacteria 787
4 Ga0068869_100326925 3300005334 Bacteria 1245
5 Ga0068869_100534301 3300005334 Bacteria 983
6 Ga0070689_100028873 3300005340 Bacteria 4195
7 Ga0070689_100829560 3300005340 Bacteria 815
8 Ga0070687_100449589 3300005343 Unclassified 857
9 Ga0070692_10875505 3300005345 Unclassified 619
10 Ga0070714_100221675 3300005435 Bacteria 1738
11 Ga0070701_10011804 3300005438 Bacteria 3922
12 Ga0070705_100363226 3300005440 Bacteria 1060
13 Ga0070678_100051505 3300005456 Bacteria 2985
14 Ga0070706_100068042 3300005467 Bacteria 3293
15 Ga0070707_100797161 3300005468 Unclassified 908
16 Ga0070698_100000275 3300005471 Bacteria 52389
17 Ga0070699_100254584 3300005518 Bacteria 1569
18 Ga0070699_100870406 3300005518 Bacteria 825
19 Ga0070686_101743167 3300005544 Unclassified 529
20 Ga0070696_100891241 3300005546 Bacteria 737
21 Ga0070693_100378212 3300005547 Bacteria 976
22 Ga0070665_100047547 3300005548 Bacteria 4306
23 Ga0070704_100774903 3300005549 Bacteria 855
24 Ga0070664_101206424 3300005564 Bacteria 714
25 Ga0068852_101086051 3300005616 Bacteria 820
26 Ga0068861_100221610 3300005719 Bacteria 1599
27 Ga0068861_100785627 3300005719 Bacteria 892
28 Ga0068851_10562210 3300005834 Unclassified 690
29 Ga0068858_100433486 3300005842 Bacteria 1265
30 Ga0068860_100239338 3300005843 Bacteria 1765
31 Ga0081455_10845895 3300005937 Bacteria 572
32 Ga0070717_10919593 3300006028 Bacteria 796
33 Ga0075430_100273090 3300006846 Bacteria 1399
34 Ga0075431_100106692 3300006847 Bacteria 2890
35 Ga0075429_100009702 3300006880 Bacteria 8346
36 Ga0075429_100345952 3300006880 Bacteria 1302
37 Ga0068865_100013217 3300006881 Bacteria 5212
38 Ga0068865_100697483 3300006881 Bacteria 867
39 Ga0075435_100059553 3300007076 Bacteria 3096
40 Ga0075435_100756819 3300007076 Bacteria 845
41 Ga0105245_10000328 3300009098 Bacteria 44782
42 Ga0105245_11874637 3300009098 Bacteria 653
43 Ga0114129_11879001 3300009147 Unclassified 727
44 Ga0157374_10221337 3300013296 Unclassified 1857
45 Ga0157372_12191186 3300013307 Bacteria 635
46 Ga0157377_10768348 3300014745 Bacteria 707
47 Ga0157376_10273396 3300014969 Bacteria 1588
48 Ga0207656_10437839 3300025321 Unclassified 660
49 Ga0207705_10157233 3300025909 Bacteria 1706
50 Ga0207684_10060438 3300025910 Bacteria 3219
51 Ga0207707_10371859 3300025912 Bacteria 1230
52 Ga0207671_10478708 3300025914 Bacteria 992
53 Ga0207662_10091385 3300025918 Bacteria 1873
54 Ga0207652_10580120 3300025921 Bacteria 1006
55 Ga0207646_10465728 3300025922 Bacteria 1140
56 Ga0207687_10000068 3300025927 Bacteria 78924
57 Ga0207664_10395550 3300025929 Bacteria 1228
58 Ga0207686_10093917 3300025934 Bacteria 1987
59 Ga0207670_10022608 3300025936 Bacteria 3900
60 Ga0207670_10388016 3300025936 Bacteria 1114
61 Ga0207670_10615060 3300025936 Bacteria 893
62 Ga0207704_10001802 3300025938 Bacteria 9603
63 Ga0207689_10073484 3300025942 Bacteria 2809
64 Ga0207689_10333328 3300025942 Bacteria 1260
65 Ga0207679_10837197 3300025945 Bacteria 840
66 Ga0207677_10258239 3300026023 Bacteria 1419
67 Ga0207703_10324914 3300026035 Bacteria 1410
68 Ga0207708_10718282 3300026075 Bacteria 855
69 Ga0207641_11767503 3300026088 Bacteria 620
70 Ga0207676_10168114 3300026095 Bacteria 1908
71 Ga0207676_10653635 3300026095 Bacteria 1015
72 Ga0207675_100149913 3300026118 Bacteria 2219
73 Ga0207683_10014403 3300026121 Bacteria 6733
74 Ga0207698_10995789 3300026142 Bacteria 849
75 Ga0268266_10039148 3300028379 Bacteria 4037
76 Ga0265337_1010593 3300028556 Unclassified 3221
77 Ga0265323_10005951 3300028653 Bacteria 5156
78 Ga0265322_10044630 3300028654 Unclassified 1262
79 Ga0307515_10063360 3300028794 Bacteria 5195
80 Ga0265338_10052739 3300028800 Bacteria 3646
81 Ga0265338_10055327 3300028800 Bacteria 3530
82 Ga0265330_10002643 3300031235 Bacteria 9725
83 Ga0265332_10044353 3300031238 Bacteria 1918
84 Ga0265320_10059491 3300031240 Bacteria 1827
85 Ga0265325_10000511 3300031241 Bacteria 28048
86 Ga0265329_10010705 3300031242 Bacteria 3358
87 Ga0265340_10000244 3300031247 Bacteria 28201
88 Ga0265339_10020099 3300031249 Bacteria 3906
89 Ga0265331_10043882 3300031250 Bacteria 2163
90 Ga0265316_10005430 3300031344 Bacteria 12385
91 Ga0307513_10008147 3300031456 Bacteria 13456
92 Ga0307509_10162298 3300031507 Bacteria 2130
93 Ga0307509_10356810 3300031507 Bacteria 1183
94 Ga0265313_10068044 3300031595 Unclassified 1646
95 Ga0307508_10184780 3300031616 Bacteria 1687
96 Ga0307508_10214327 3300031616 Unclassified 1526
97 Ga0265314_10000030 3300031711 Bacteria 266231
98 Ga0265314_10308047 3300031711 Bacteria 886
99 Ga0265342_10003686 3300031712 Bacteria 12423
100 Ga0316576_10000164 3300031727 Bacteria 26995
101 Ga0316578_10018842 3300031728 Bacteria 3790
102 Ga0316577_10000817 3300031733 Bacteria 13551
103 Ga0307406_10160934 3300031901 Bacteria 1613
104 Ga0307415_100031777 3300032126 Bacteria 3406
105 Ga0307415_100054355 3300032126 Bacteria 2733
106 Ga0316585_10103645 3300032137 Bacteria 934
107 Ga0307507_10411428 3300033179 Bacteria 764
108 Ga0373949_0000390 3300035090 Bacteria 15340
109 Ga0373952_0157094 3300035092 Bacteria 642
110 Ga0373936_0000013 3300035113 Bacteria 219069
111 Ga0373941_0009283 3300035115 Bacteria 2472
112 Ga0373956_0062994 3300035119 Bacteria 1681
113 Ga0373957_0129001 3300035120 Bacteria 1028
114 Ga0373961_0000049 3300035241 Bacteria 70367
115 Ga0395899_0110753 3300037312 Bacteria 1974
116 Ga0395900_0063275 3300037418 Bacteria 3803
117 Ga0395898_0176288 3300037466 Bacteria 2043
118 Ga0395905_0459117 3300037471 Unclassified 1172
119 Ga0395901_0034085 3300038443 Bacteria 5257
120 Ga0451843_0066031 3300041509 Unclassified 636
121 Ga0451853_2444300 3300041512 Unclassified 862
122 Ga0451853_2567450 3300041512 Bacteria 670
123 Ga0466957_0771666 3300044842 Bacteria 682
124 Ga0466967_0935682 3300045976 Unclassified 862
125 Ga0466967_2070089 3300045976 Bacteria 566
126 Ga0495629_0089817 3300046459 Bacteria 2143
127 Ga0495650_0032986 3300046471 Bacteria 2310
128 Ga0495594_0280427 3300046499 Bacteria 950
129 Ga0495649_0225681 3300046694 Unclassified 968
130 Ga0495686_0013721 3300047472 Bacteria 5614
131 Ga0496100_1291144 3300048903 Bacteria 576
132 Ga0496112_0671279 3300048915 Bacteria 965
133 Ga0501292_041523 3300049515 Bacteria 795
134 Ga0501298_080809 3300049521 Bacteria 715
135 Ga0501034_0836711 3300049571 Bacteria 811
136 Ga0501036_0318468 3300049572 Bacteria 1300
137 Ga0501037_0384152 3300049573 Bacteria 965
138 Ga0501046_0474702 3300049580 Bacteria 898
139 Ga0501047_0154552 3300049581 Bacteria 2168
140 Ga0501067_0145732 3300049583 Bacteria 1319
141 Ga0501069_0041356 3300049585 Bacteria 2547
142 Ga0501070_0032552 3300049586 Bacteria 4364
143 Ga0501070_0046995 3300049586 Bacteria 3590
144 Ga0501070_0066731 3300049586 Bacteria 2979
145 Ga0501072_0370820 3300049588 Bacteria 1136
146 Ga0501073_0297699 3300049589 Bacteria 1113
147 Ga0501074_0153622 3300049590 Bacteria 1645
148 Ga0501074_0231554 3300049590 Bacteria 1315
149 Ga0501077_0142016 3300049593 Bacteria 1523
150 Ga0501209_110601 3300049656 Bacteria 810
151 Ga0501227_000738 3300049665 Bacteria 7141
152 Ga0501227_016043 3300049665 Bacteria 1679
153 Ga0501230_033876 3300049667 Bacteria 964
154 Ga0501233_000519 3300049668 Bacteria 6174
155 Ga0501249_133793 3300049679 Unclassified 613
156 Ga0501225_0003963 3300049705 Unclassified 4431
157 Ga0501079_0546753 3300049741 Bacteria 911
158 Ga0501079_0821131 3300049741 Unclassified 732
159 Ga0501080_0099460 3300049742 Unclassified 2699
160 Ga0501080_0850444 3300049742 Bacteria 798
161 Ga0501083_0036373 3300049744 Bacteria 3358
162 Ga0501035_0453128 3300049822 Bacteria 1061
163 Ga0501044_0289864 3300049823 Bacteria 1568
164 nmdc:mga05p37_1432528_c1 3300050507 Bacteria 693
165 nmdc:mga05p37_2067378_c1 3300050507 Unclassified 535
166 nmdc:mga09592_115237_c1 3300050508 Bacteria 2307
167 nmdc:mga09592_19021_c1 3300050508 Bacteria 5636
168 nmdc:mga09592_29700_c1 3300050508 Bacteria 4546
169 nmdc:mga0qj67_109680_c1 3300050509 Bacteria 2227
170 nmdc:mga06r32_95532_c1 3300050510 Bacteria 2909
171 nmdc:mga0rr50_675802_c1 3300050513 Bacteria 881
172 nmdc:mga08x19_798547_c1 3300050514 Bacteria 670
173 Ga0500583_0254195 3300053092 Bacteria 867
174 Ga0500566_0227741 3300053094 Bacteria 922
175 Ga0500597_002900 3300053120 Bacteria 4910
176 Ga0500614_016439 3300053123 Unclassified 1660
177 Ga0500658_0180245 3300053134 Bacteria 962
178 Ga0500630_042340 3300053159 Bacteria 2222
179 Ga0500638_278229 3300053162 Bacteria 658
180 Ga0500639_155697 3300053163 Bacteria 1047
181 Ga0501084_0239157 3300054114 Bacteria 1533
182 Ga0500661_057555 3300055283 Bacteria 699

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100534301 Ga0068869_1005343012 136
2 3300005345 Ga0070692_10875505 Ga0070692_108755051 136
3 3300005616 Ga0068852_101086051 Ga0068852_1010860512 136
4 3300025914 Ga0207671_10478708 Ga0207671_104787082 136
5 3300025927 Ga0207687_10000068 Ga0207687_1000006848 136
6 3300025942 Ga0207689_10073484 Ga0207689_100734843 136
7 3300026023 Ga0207677_10258239 Ga0207677_102582392 136
8 3300026095 Ga0207676_10168114 Ga0207676_101681143 136
9 3300026142 Ga0207698_10995789 Ga0207698_109957892 136
10 3300031711 Ga0265314_10308047 Ga0265314_103080472 136
11 3300005467 Ga0070706_100068042 Ga0070706_1000680423 138
12 3300005544 Ga0070686_101743167 Ga0070686_1017431671 138
13 3300005937 Ga0081455_10845895 Ga0081455_108458951 138
14 3300006846 Ga0075430_100273090 Ga0075430_1002730902 138
15 3300025910 Ga0207684_10060438 Ga0207684_100604383 138
16 3300026088 Ga0207641_11767503 Ga0207641_117675032 138
17 3300005334 Ga0068869_100326925 Ga0068869_1003269252 139
18 3300005438 Ga0070701_10011804 Ga0070701_100118042 139
19 3300005440 Ga0070705_100363226 Ga0070705_1003632262 139
20 3300009098 Ga0105245_11874637 Ga0105245_118746371 139
21 3300025936 Ga0207670_10388016 Ga0207670_103880162 139
22 3300025942 Ga0207689_10333328 Ga0207689_103333282 139
23 3300026075 Ga0207708_10718282 Ga0207708_107182822 139
24 3300035120 Ga0373957_0129001 Ga0373957_0129001_424_984 139
25 3300035241 Ga0373961_0000049 Ga0373961_0000049_1075_1494 139
26 3300045976 Ga0466967_2070089 Ga0466967_2070089_85_507 140
27 3300005842 Ga0068858_100433486 Ga0068858_1004334862 142
28 3300025934 Ga0207686_10093917 Ga0207686_100939173 142
29 3300026035 Ga0207703_10324914 Ga0207703_103249142 142
30 3300025909 Ga0207705_10157233 Ga0207705_101572332 143
31 3300031616 Ga0307508_10214327 Ga0307508_102143272 143
32 3300048903 Ga0496100_1291144 Ga0496100_1291144_120_551 143
33 3300028556 Ga0265337_1010593 Ga0265337_10105931 144
34 3300028653 Ga0265323_10005951 Ga0265323_100059516 144
35 3300028654 Ga0265322_10044630 Ga0265322_100446302 144
36 3300028800 Ga0265338_10055327 Ga0265338_100553273 144
37 3300031235 Ga0265330_10002643 Ga0265330_100026432 144
38 3300031238 Ga0265332_10044353 Ga0265332_100443532 144
39 3300031240 Ga0265320_10059491 Ga0265320_100594912 144
40 3300031241 Ga0265325_10000511 Ga0265325_1000051115 144
41 3300031242 Ga0265329_10010705 Ga0265329_100107053 144
42 3300031247 Ga0265340_10000244 Ga0265340_100002448 144
43 3300031249 Ga0265339_10020099 Ga0265339_100200992 144
44 3300031250 Ga0265331_10043882 Ga0265331_100438821 144
45 3300031344 Ga0265316_10005430 Ga0265316_100054308 144
46 3300031595 Ga0265313_10068044 Ga0265313_100680442 144
47 3300031711 Ga0265314_10000030 Ga0265314_10000030109 144
48 3300031712 Ga0265342_10003686 Ga0265342_100036863 144
49 3300005329 Ga0070683_101037916 Ga0070683_1010379162 145
50 3300005834 Ga0068851_10562210 Ga0068851_105622102 145
51 3300025321 Ga0207656_10437839 Ga0207656_104378391 145
52 3300028794 Ga0307515_10063360 Ga0307515_100633604 145
53 3300032126 Ga0307415_100031777 Ga0307415_1000317773 145
54 3300035115 Ga0373941_0009283 Ga0373941_0009283_1016_1453 145
55 3300005456 Ga0070678_100051505 Ga0070678_1000515052 146
56 3300005549 Ga0070704_100774903 Ga0070704_1007749032 146
57 3300013296 Ga0157374_10221337 Ga0157374_102213372 146
58 3300013307 Ga0157372_12191186 Ga0157372_121911861 146
59 3300025921 Ga0207652_10580120 Ga0207652_105801202 146
60 3300026121 Ga0207683_10014403 Ga0207683_100144037 146
61 3300037312 Ga0395899_0110753 Ga0395899_0110753_59_535 146
62 3300037418 Ga0395900_0063275 Ga0395900_0063275_2389_2865 146
63 3300037466 Ga0395898_0176288 Ga0395898_0176288_191_667 146
64 3300038443 Ga0395901_0034085 Ga0395901_0034085_348_824 146
65 3300044842 Ga0466957_0771666 Ga0466957_0771666_126_602 146
66 3300045976 Ga0466967_0935682 Ga0466967_0935682_284_760 146
67 3300049572 Ga0501036_0318468 Ga0501036_0318468_705_1181 146
68 3300049573 Ga0501037_0384152 Ga0501037_0384152_180_656 146
69 3300049580 Ga0501046_0474702 Ga0501046_0474702_296_772 146
70 3300049581 Ga0501047_0154552 Ga0501047_0154552_481_987 146
71 3300049586 Ga0501070_0046995 Ga0501070_0046995_215_691 146
72 3300049590 Ga0501074_0231554 Ga0501074_0231554_646_1122 146
73 3300049741 Ga0501079_0546753 Ga0501079_0546753_205_681 146
74 3300049742 Ga0501080_0850444 Ga0501080_0850444_232_720 146
75 3300049822 Ga0501035_0453128 Ga0501035_0453128_64_570 146
76 3300049823 Ga0501044_0289864 Ga0501044_0289864_868_1344 146
77 3300005468 Ga0070707_100797161 Ga0070707_1007971612 147
78 3300025922 Ga0207646_10465728 Ga0207646_104657282 147
79 3300005518 Ga0070699_100870406 Ga0070699_1008704062 148
80 3300005548 Ga0070665_100047547 Ga0070665_1000475474 148
81 3300005719 Ga0068861_100785627 Ga0068861_1007856272 148
82 3300006880 Ga0075429_100345952 Ga0075429_1003459522 148
83 3300007076 Ga0075435_100059553 Ga0075435_1000595533 148
84 3300009098 Ga0105245_10000328 Ga0105245_1000032827 148
85 3300014969 Ga0157376_10273396 Ga0157376_102733963 148
86 3300025936 Ga0207670_10615060 Ga0207670_106150602 148
87 3300028379 Ga0268266_10039148 Ga0268266_100391483 148
88 3300028800 Ga0265338_10052739 Ga0265338_100527393 148
89 3300046471 Ga0495650_0032986 Ga0495650_0032986_681_1163 148
90 3300050507 nmdc:mga05p37_1432528_c1 nmdc:mga05p37_1432528_c1_88_570 148
91 3300050508 nmdc:mga09592_115237_c1 nmdc:mga09592_115237_c1_1222_1704 148
92 3300050508 nmdc:mga09592_19021_c1 nmdc:mga09592_19021_c1_2502_2984 148
93 3300050513 nmdc:mga0rr50_675802_c1 nmdc:mga0rr50_675802_c1_102_584 148
94 3300050514 nmdc:mga08x19_798547_c1 nmdc:mga08x19_798547_c1_71_553 148
95 3300005327 Ga0070658_10320198 Ga0070658_103201982 149
96 3300033179 Ga0307507_10411428 Ga0307507_104114282 149
97 3300049583 Ga0501067_0145732 Ga0501067_0145732_402_887 149
98 3300049586 Ga0501070_0066731 Ga0501070_0066731_1387_1872 149
99 3300049742 Ga0501080_0099460 Ga0501080_0099460_537_1022 149
100 3300005340 Ga0070689_100028873 Ga0070689_1000288734 150
101 3300005435 Ga0070714_100221675 Ga0070714_1002216752 150
102 3300005471 Ga0070698_100000275 Ga0070698_1000002757 150
103 3300005518 Ga0070699_100254584 Ga0070699_1002545842 150
104 3300005546 Ga0070696_100891241 Ga0070696_1008912411 150
105 3300005564 Ga0070664_101206424 Ga0070664_1012064242 150
106 3300006028 Ga0070717_10919593 Ga0070717_109195932 150
107 3300006881 Ga0068865_100013217 Ga0068865_1000132174 150
108 3300007076 Ga0075435_100756819 Ga0075435_1007568192 150
109 3300009147 Ga0114129_11879001 Ga0114129_118790012 150
110 3300025918 Ga0207662_10091385 Ga0207662_100913853 150
111 3300025929 Ga0207664_10395550 Ga0207664_103955502 150
112 3300025936 Ga0207670_10022608 Ga0207670_100226084 150
113 3300025938 Ga0207704_10001802 Ga0207704_100018023 150
114 3300025945 Ga0207679_10837197 Ga0207679_108371972 150
115 3300031456 Ga0307513_10008147 Ga0307513_100081478 150
116 3300031507 Ga0307509_10162298 Ga0307509_101622981 150
117 3300031507 Ga0307509_10356810 Ga0307509_103568102 150
118 3300032126 Ga0307415_100054355 Ga0307415_1000543553 150
119 3300046499 Ga0495594_0280427 Ga0495594_0280427_380_868 150
120 3300046694 Ga0495649_0225681 Ga0495649_0225681_328_816 150
121 3300049515 Ga0501292_041523 Ga0501292_041523_186_674 150
122 3300049521 Ga0501298_080809 Ga0501298_080809_110_598 150
123 3300049585 Ga0501069_0041356 Ga0501069_0041356_714_1202 150
124 3300049588 Ga0501072_0370820 Ga0501072_0370820_482_970 150
125 3300049589 Ga0501073_0297699 Ga0501073_0297699_73_561 150
126 3300049593 Ga0501077_0142016 Ga0501077_0142016_291_779 150
127 3300049656 Ga0501209_110601 Ga0501209_110601_272_760 150
128 3300049665 Ga0501227_000738 Ga0501227_000738_4198_4686 150
129 3300049665 Ga0501227_016043 Ga0501227_016043_741_1229 150
130 3300049667 Ga0501230_033876 Ga0501230_033876_122_610 150
131 3300049668 Ga0501233_000519 Ga0501233_000519_3487_3975 150
132 3300049679 Ga0501249_133793 Ga0501249_133793_37_525 150
133 3300049705 Ga0501225_0003963 Ga0501225_0003963_1053_1541 150
134 3300049741 Ga0501079_0821131 Ga0501079_0821131_220_708 150
135 3300049744 Ga0501083_0036373 Ga0501083_0036373_1250_1738 150
136 3300050507 nmdc:mga05p37_2067378_c1 nmdc:mga05p37_2067378_c1_13_501 150
137 3300053134 Ga0500658_0180245 Ga0500658_0180245_142_630 150
138 3300054114 Ga0501084_0239157 Ga0501084_0239157_400_888 150
139 3300003323 rootH1_10076483 rootH1_100764832 151
140 3300005340 Ga0070689_100829560 Ga0070689_1008295602 151
141 3300005343 Ga0070687_100449589 Ga0070687_1004495891 151
142 3300005547 Ga0070693_100378212 Ga0070693_1003782122 151
143 3300005719 Ga0068861_100221610 Ga0068861_1002216102 151
144 3300005843 Ga0068860_100239338 Ga0068860_1002393382 151
145 3300006847 Ga0075431_100106692 Ga0075431_1001066923 151
146 3300006880 Ga0075429_100009702 Ga0075429_1000097026 151
147 3300006881 Ga0068865_100697483 Ga0068865_1006974832 151
148 3300014745 Ga0157377_10768348 Ga0157377_107683481 151
149 3300025912 Ga0207707_10371859 Ga0207707_103718592 151
150 3300026095 Ga0207676_10653635 Ga0207676_106536352 151
151 3300026118 Ga0207675_100149913 Ga0207675_1001499132 151
152 3300031616 Ga0307508_10184780 Ga0307508_101847802 151
153 3300031727 Ga0316576_10000164 Ga0316576_1000016424 151
154 3300031728 Ga0316578_10018842 Ga0316578_100188423 151
155 3300031733 Ga0316577_10000817 Ga0316577_100008179 151
156 3300031901 Ga0307406_10160934 Ga0307406_101609342 151
157 3300032137 Ga0316585_10103645 Ga0316585_101036451 151
158 3300035090 Ga0373949_0000390 Ga0373949_0000390_1350_1841 151
159 3300035092 Ga0373952_0157094 Ga0373952_0157094_140_631 151
160 3300035113 Ga0373936_0000013 Ga0373936_0000013_65189_65680 151
161 3300035119 Ga0373956_0062994 Ga0373956_0062994_348_839 151
162 3300037471 Ga0395905_0459117 Ga0395905_0459117_604_1095 151
163 3300041509 Ga0451843_0066031 Ga0451843_0066031_127_606 151
164 3300041512 Ga0451853_2444300 Ga0451853_2444300_13_492 151
165 3300041512 Ga0451853_2567450 Ga0451853_2567450_181_654 151
166 3300046459 Ga0495629_0089817 Ga0495629_0089817_913_1389 151
167 3300047472 Ga0495686_0013721 Ga0495686_0013721_914_1417 151
168 3300048915 Ga0496112_0671279 Ga0496112_0671279_180_677 151
169 3300049571 Ga0501034_0836711 Ga0501034_0836711_74_565 151
170 3300049586 Ga0501070_0032552 Ga0501070_0032552_705_1196 151
171 3300049590 Ga0501074_0153622 Ga0501074_0153622_434_913 151
172 3300050508 nmdc:mga09592_29700_c1 nmdc:mga09592_29700_c1_1267_1770 151
173 3300050509 nmdc:mga0qj67_109680_c1 nmdc:mga0qj67_109680_c1_1469_1972 151
174 3300050510 nmdc:mga06r32_95532_c1 nmdc:mga06r32_95532_c1_2313_2816 151
175 3300053092 Ga0500583_0254195 Ga0500583_0254195_194_685 151
176 3300053094 Ga0500566_0227741 Ga0500566_0227741_142_633 151
177 3300053120 Ga0500597_002900 Ga0500597_002900_1412_1903 151
178 3300053123 Ga0500614_016439 Ga0500614_016439_16_507 151
179 3300053159 Ga0500630_042340 Ga0500630_042340_1551_2042 151
180 3300053162 Ga0500638_278229 Ga0500638_278229_80_571 151
181 3300053163 Ga0500639_155697 Ga0500639_155697_190_681 151
182 3300055283 Ga0500661_057555 Ga0500661_057555_45_536 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

105

152

0.96

PF04542

Sigma70_r2

Sigma-70 region 2

3

71

0.92

PF08281

Sigma70_r4_2

Sigma-70, region 4

97

150

0.87

PF07638

Sigma70_ECF

ECF sigma factor

2

153

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2w48-assembly1.cif.gz_A crystal structure of the full-length sorbitol operon regulator sorc from klebsiella pneumoniae 0.9837 101 136
4go1-assembly1.cif.gz_A-2 crystal structure of full length transcription repressor lsrr from e. coli. 0.975 100 135
7vim-assembly1.cif.gz_B-2 the c-terminal dna binding domain of esrb from edwardsiella piscicida 0.9723 98 150
7bhy-assembly1.cif.gz_B dna-binding domain of deor in complex with the dna operator 0.9627 102 139
4go1-assembly1.cif.gz_B-2 crystal structure of full length transcription repressor lsrr from e. coli. 0.9622 102 139
ID Description Score Start End Superfamily
2w48A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9837 101 136 1.10.10.60
4l5jB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9697 100 136 1.10.10.10
4go1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9622 102 139 1.10.10.10
4go1A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.955 100 140 1.10.10.10
4l5jC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9488 102 140 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A538PMU4-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.8429 2 151 GO:0003677
GO:0006352
GO:0016987
AF-A0A538PMU4-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.8269 2 151 GO:0003677
GO:0006352
GO:0016987
AF-A0A3M1CY69-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.8027 3 144 GO:0003677
GO:0006352
GO:0016987
AF-A0A7X9HMX4-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.7861 2 147 GO:0003677
GO:0006352
GO:0016987
AF-A0A0G3A415-F1-model_v4 deleted 0.7685 2 146

Feature Viewer

pLDDT pTM Quality
87.01 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map