F278026

General Info

Members Datasets Scaffolds Average Seq Length
181 137 362 130

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0249222|Ga0496102_0249222_1036_1482
Length 148
Sequence MRQAGASCDQRSRLWHAEPVPLDPCRLPDDVLTFLAERHLATLTTLRPDGSPHVVPVGFTWDDESHVVRVITSGPSRKARNAGGGGRAVVAQVDGRRWLSLEGPVRVLTDAAAVREAEQRYAVRYRTPRENPVRVVLEIRVDRVLGHA

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
79 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
80 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
81 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
82 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
83 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
84 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
85 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
86 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
87 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
88 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
89 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
90 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
91 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
106 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
127 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
130 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
131 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
132 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
133 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
134 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
135 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
137 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.94
Nodule 0
Rhizoplane 9.94
Rhizosphere 74.59
Stem 0
Stem Tuber 0
Unclassified 3.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0249222 3300048905 Bacteria 1674
2 Ga0070690_100442844 3300005330 Bacteria 962
3 Ga0070680_100506775 3300005336 Bacteria 1033
4 Ga0070682_102055418 3300005337 Bacteria 503
5 Ga0070689_100046267 3300005340 Bacteria 3352
6 Ga0070687_100349705 3300005343 Bacteria 953
7 Ga0070688_100069279 3300005365 Bacteria 2252
8 Ga0070703_10022741 3300005406 Bacteria 1842
9 Ga0070705_100137485 3300005440 Bacteria 1603
10 Ga0070694_101252279 3300005444 Bacteria 623
11 Ga0070708_100089204 3300005445 Bacteria 2805
12 Ga0070678_100610195 3300005456 Bacteria 975
13 Ga0070681_10024515 3300005458 Bacteria 6072
14 Ga0070685_10215791 3300005466 Bacteria 1254
15 Ga0070706_100100022 3300005467 Bacteria 2694
16 Ga0070707_101728928 3300005468 Bacteria 593
17 Ga0070679_100246756 3300005530 Bacteria 1742
18 Ga0070686_100702476 3300005544 Unclassified 807
19 Ga0070695_100071608 3300005545 Bacteria 2271
20 Ga0070695_100743593 3300005545 Unclassified 782
21 Ga0070704_100471111 3300005549 Bacteria 1085
22 Ga0068855_100272746 3300005563 Bacteria 1881
23 Ga0068855_100433445 3300005563 Bacteria 1436
24 Ga0068854_101175133 3300005578 Bacteria 686
25 Ga0068856_102474957 3300005614 Bacteria 526
26 Ga0070702_100315097 3300005615 Bacteria 1088
27 Ga0068864_101568888 3300005618 Bacteria 662
28 Ga0068866_10035163 3300005718 Bacteria 2445
29 Ga0068870_10185682 3300005840 Bacteria 1251
30 Ga0068863_100517826 3300005841 Bacteria 1176
31 Ga0068858_100312888 3300005842 Bacteria 1500
32 Ga0075365_10117932 3300006038 Bacteria 1829
33 Ga0075365_10203330 3300006038 Bacteria 1388
34 Ga0075365_10649118 3300006038 Bacteria 746
35 Ga0075368_10286115 3300006042 Bacteria 709
36 Ga0075364_10238083 3300006051 Bacteria 1236
37 Ga0097621_100389445 3300006237 Bacteria 1246
38 Ga0097621_101951108 3300006237 Bacteria 560
39 Ga0075370_10266628 3300006353 Bacteria 1016
40 Ga0075430_100206347 3300006846 Bacteria 1631
41 Ga0068865_100047066 3300006881 Bacteria 2962
42 Ga0105243_11126188 3300009148 Bacteria 794
43 Ga0105242_10003103 3300009176 Bacteria 12964
44 Ga0105248_10297590 3300009177 Bacteria 1817
45 Ga0105238_10353313 3300009551 Bacteria 1459
46 Ga0157369_10219121 3300013105 Bacteria 1992
47 Ga0157378_10120892 3300013297 Bacteria 2414
48 Ga0157375_12330582 3300013308 Bacteria 638
49 Ga0157380_10716929 3300014326 Bacteria 1007
50 Ga0157379_10091371 3300014968 Bacteria 2731
51 Ga0207684_10050649 3300025910 Bacteria 3523
52 Ga0207707_10051940 3300025912 Bacteria 3569
53 Ga0207707_10074668 3300025912 Bacteria 2957
54 Ga0207695_10245911 3300025913 Bacteria 1689
55 Ga0207660_10345612 3300025917 Bacteria 1192
56 Ga0207662_10100835 3300025918 Bacteria 1788
57 Ga0207657_10384632 3300025919 Bacteria 1104
58 Ga0207652_10392817 3300025921 Bacteria 1252
59 Ga0207652_11510517 3300025921 Bacteria 576
60 Ga0207694_10240818 3300025924 Bacteria 1478
61 Ga0207644_10501044 3300025931 Bacteria 1002
62 Ga0207690_11517969 3300025932 Bacteria 560
63 Ga0207670_10162270 3300025936 Bacteria 1669
64 Ga0207667_10113973 3300025949 Bacteria 2787
65 Ga0207667_11442423 3300025949 Bacteria 661
66 Ga0207640_10775010 3300025981 Bacteria 829
67 Ga0207703_10472752 3300026035 Bacteria 1174
68 Ga0207641_10240815 3300026088 Bacteria 1686
69 Ga0207648_10004020 3300026089 Bacteria 15267
70 Ga0207683_10302560 3300026121 Bacteria 1463
71 Ga0207698_11739168 3300026142 Bacteria 639
72 Ga0307513_10010865 3300031456 Bacteria 11372
73 Ga0307513_10432479 3300031456 Bacteria 1044
74 Ga0307408_100611168 3300031548 Bacteria 970
75 Ga0307413_10500066 3300031824 Bacteria 976
76 Ga0307410_10948645 3300031852 Bacteria 739
77 Ga0307406_11030709 3300031901 Bacteria 707
78 Ga0307407_10692719 3300031903 Bacteria 767
79 Ga0307412_10700462 3300031911 Bacteria 869
80 Ga0307412_11657051 3300031911 Bacteria 585
81 Ga0307409_100251435 3300031995 Bacteria 1616
82 Ga0307409_101204642 3300031995 Bacteria 781
83 Ga0307416_100325416 3300032002 Bacteria 1542
84 Ga0307416_100653036 3300032002 Bacteria 1137
85 Ga0307416_100877606 3300032002 Bacteria 996
86 Ga0307416_100916685 3300032002 Bacteria 977
87 Ga0307415_100106657 3300032126 Bacteria 2069
88 Ga0307415_100704122 3300032126 Bacteria 912
89 Ga0316574_0151267 3300035398 Bacteria 1495
90 Ga0395899_0585942 3300037312 Bacteria 712
91 Ga0395900_0158962 3300037418 Bacteria 2306
92 Ga0395901_0027560 3300038443 Bacteria 5839
93 Ga0400483_036901 3300039062 Bacteria 6259
94 Ga0400483_268935 3300039062 Unclassified 4818
95 Ga0436363_0478894 3300039450 Bacteria 1598
96 Ga0439439_0078166 3300041406 Unclassified 892
97 Ga0451789_0567279 3300041443 Bacteria 987
98 Ga0451791_1671844 3300041451 Bacteria 962
99 Ga0451797_1316569 3300041453 Bacteria 2099
100 Ga0451798_1011147 3300041458 Bacteria 839
101 Ga0451800_1559147 3300041459 Bacteria 776
102 Ga0451833_0156224 3300041491 Bacteria 1667
103 Ga0451837_1186042 3300041494 Bacteria 547
104 Ga0451845_0954608 3300041501 Bacteria 625
105 Ga0451843_0310792 3300041509 Bacteria 684
106 Ga0451853_2706696 3300041512 Bacteria 548
107 Ga0439452_016355 3300042010 Bacteria 2016
108 Ga0451577_0000427 3300042876 Bacteria 75491
109 Ga0466969_0240927 3300044656 Bacteria 821
110 Ga0466969_0550113 3300044656 Unclassified 528
111 Ga0466965_0077560 3300044683 Bacteria 1678
112 Ga0466965_0172768 3300044683 Bacteria 1137
113 Ga0466965_0471706 3300044683 Bacteria 701
114 Ga0466965_0795065 3300044683 Bacteria 547
115 Ga0466966_0101760 3300044684 Bacteria 1776
116 Ga0466966_0234274 3300044684 Bacteria 1107
117 Ga0466961_0147500 3300044693 Bacteria 1470
118 Ga0466961_0231177 3300044693 Bacteria 1138
119 Ga0466961_0245477 3300044693 Bacteria 1100
120 Ga0466961_0441542 3300044693 Bacteria 788
121 Ga0466964_0602723 3300044706 Bacteria 602
122 Ga0453684_0015353 3300044712 Bacteria 12129
123 Ga0466970_0236466 3300044765 Bacteria 1022
124 Ga0466957_0227653 3300044842 Bacteria 1233
125 Ga0466957_0422870 3300044842 Bacteria 914
126 Ga0466957_0433481 3300044842 Bacteria 903
127 Ga0466957_0528080 3300044842 Bacteria 820
128 Ga0466960_0670650 3300044901 Bacteria 620
129 Ga0466959_0192397 3300045049 Bacteria 1423
130 Ga0466959_0355373 3300045049 Bacteria 999
131 Ga0466959_0609791 3300045049 Bacteria 734
132 Ga0466958_0087399 3300045836 Bacteria 1924
133 Ga0466958_0222341 3300045836 Bacteria 1205
134 Ga0466958_1155908 3300045836 Bacteria 505
135 Ga0466967_0143275 3300045976 Bacteria 2227
136 Ga0466967_0170278 3300045976 Bacteria 2048
137 Ga0466967_0212705 3300045976 Bacteria 1834
138 Ga0466967_2193023 3300045976 Bacteria 548
139 Ga0495641_0038077 3300046461 Bacteria 2249
140 Ga0495608_0368248 3300046511 Bacteria 882
141 Ga0495618_0420546 3300046514 Bacteria 815
142 Ga0495630_0124298 3300046517 Bacteria 1958
143 Ga0495587_0132427 3300046536 Bacteria 1425
144 Ga0495587_0267906 3300046536 Bacteria 959
145 Ga0495645_0305426 3300046543 Bacteria 1038
146 Ga0495667_0161439 3300046559 Bacteria 1442
147 Ga0495635_0158412 3300046663 Unclassified 1541
148 Ga0495657_0562031 3300046675 Bacteria 662
149 Ga0495581_0095874 3300047315 Bacteria 1723
150 Ga0495604_0965826 3300047317 Bacteria 529
151 Ga0496101_0120771 3300048904 Bacteria 1981
152 Ga0496102_0059517 3300048905 Bacteria 3493
153 Ga0496102_0938038 3300048905 Bacteria 787
154 Ga0496107_0463983 3300048910 Bacteria 940
155 Ga0496107_0763795 3300048910 Bacteria 709
156 Ga0496109_1779616 3300048912 Bacteria 549
157 Ga0496110_0710106 3300048913 Bacteria 907
158 Ga0496111_0220004 3300048914 Bacteria 1411
159 Ga0496114_0085284 3300048917 Bacteria 2675
160 Ga0496114_0087350 3300048917 Bacteria 2644
161 Ga0496114_1689529 3300048917 Bacteria 521
162 Ga0496115_0880915 3300048918 Bacteria 691
163 Ga0501034_0000257 3300049571 Bacteria 96799
164 Ga0501070_0086074 3300049586 Unclassified 2602
165 nmdc:mga00v17_104919_c1 3300050491 Bacteria 1787
166 nmdc:mga00v17_444743_c1 3300050491 Bacteria 841
167 nmdc:mga0yw44_168213_c1 3300050492 Bacteria 1438
168 nmdc:mga0yw44_421207_c1 3300050492 Bacteria 904
169 nmdc:mga04h51_245206_c1 3300050495 Bacteria 716
170 nmdc:mga0qj67_328153_c1 3300050509 Bacteria 1238
171 Ga0500635_0011287 3300053080 Bacteria 2535
172 Ga0495595_0291031 3300053084 Bacteria 821
173 Ga0500643_000369 3300053087 Bacteria 35468
174 Ga0500583_0357089 3300053092 Bacteria 707
175 Ga0500628_027630 3300053129 Bacteria 1205
176 Ga0500568_0170088 3300053139 Bacteria 802
177 Ga0500616_0000141 3300053153 Bacteria 122164
178 Ga0500616_0000889 3300053153 Bacteria 32810
179 Ga0466962_0091017 3300061719 Bacteria 1461
180 Ga0466962_0476223 3300061719 Bacteria 630
181 2729905576 2728369276 Bacteria 5610032
182 Ga0496102_0249222
183 Ga0070690_100442844
184 Ga0070680_100506775
185 Ga0070682_102055418
186 Ga0070689_100046267
187 Ga0070687_100349705
188 Ga0070688_100069279
189 Ga0070703_10022741
190 Ga0070705_100137485
191 Ga0070694_101252279
192 Ga0070708_100089204
193 Ga0070678_100610195
194 Ga0070681_10024515
195 Ga0070685_10215791
196 Ga0070706_100100022
197 Ga0070707_101728928
198 Ga0070679_100246756
199 Ga0070686_100702476
200 Ga0070695_100071608
201 Ga0070695_100743593
202 Ga0070704_100471111
203 Ga0068855_100272746
204 Ga0068855_100433445
205 Ga0068854_101175133
206 Ga0068856_102474957
207 Ga0070702_100315097
208 Ga0068864_101568888
209 Ga0068866_10035163
210 Ga0068870_10185682
211 Ga0068863_100517826
212 Ga0068858_100312888
213 Ga0075365_10117932
214 Ga0075365_10203330
215 Ga0075365_10649118
216 Ga0075368_10286115
217 Ga0075364_10238083
218 Ga0097621_100389445
219 Ga0097621_101951108
220 Ga0075370_10266628
221 Ga0075430_100206347
222 Ga0068865_100047066
223 Ga0105243_11126188
224 Ga0105242_10003103
225 Ga0105248_10297590
226 Ga0105238_10353313
227 Ga0157369_10219121
228 Ga0157378_10120892
229 Ga0157375_12330582
230 Ga0157380_10716929
231 Ga0157379_10091371
232 Ga0207684_10050649
233 Ga0207707_10051940
234 Ga0207707_10074668
235 Ga0207695_10245911
236 Ga0207660_10345612
237 Ga0207662_10100835
238 Ga0207657_10384632
239 Ga0207652_10392817
240 Ga0207652_11510517
241 Ga0207694_10240818
242 Ga0207644_10501044
243 Ga0207690_11517969
244 Ga0207670_10162270
245 Ga0207667_10113973
246 Ga0207667_11442423
247 Ga0207640_10775010
248 Ga0207703_10472752
249 Ga0207641_10240815
250 Ga0207648_10004020
251 Ga0207683_10302560
252 Ga0207698_11739168
253 Ga0307513_10010865
254 Ga0307513_10432479
255 Ga0307408_100611168
256 Ga0307413_10500066
257 Ga0307410_10948645
258 Ga0307406_11030709
259 Ga0307407_10692719
260 Ga0307412_10700462
261 Ga0307412_11657051
262 Ga0307409_100251435
263 Ga0307409_101204642
264 Ga0307416_100325416
265 Ga0307416_100653036
266 Ga0307416_100877606
267 Ga0307416_100916685
268 Ga0307415_100106657
269 Ga0307415_100704122
270 Ga0316574_0151267
271 Ga0395899_0585942
272 Ga0395900_0158962
273 Ga0395901_0027560
274 Ga0400483_036901
275 Ga0400483_268935
276 Ga0436363_0478894
277 Ga0439439_0078166
278 Ga0451789_0567279
279 Ga0451791_1671844
280 Ga0451797_1316569
281 Ga0451798_1011147
282 Ga0451800_1559147
283 Ga0451833_0156224
284 Ga0451837_1186042
285 Ga0451845_0954608
286 Ga0451843_0310792
287 Ga0451853_2706696
288 Ga0439452_016355
289 Ga0451577_0000427
290 Ga0466969_0240927
291 Ga0466969_0550113
292 Ga0466965_0077560
293 Ga0466965_0172768
294 Ga0466965_0471706
295 Ga0466965_0795065
296 Ga0466966_0101760
297 Ga0466966_0234274
298 Ga0466961_0147500
299 Ga0466961_0231177
300 Ga0466961_0245477
301 Ga0466961_0441542
302 Ga0466964_0602723
303 Ga0453684_0015353
304 Ga0466970_0236466
305 Ga0466957_0227653
306 Ga0466957_0422870
307 Ga0466957_0433481
308 Ga0466957_0528080
309 Ga0466960_0670650
310 Ga0466959_0192397
311 Ga0466959_0355373
312 Ga0466959_0609791
313 Ga0466958_0087399
314 Ga0466958_0222341
315 Ga0466958_1155908
316 Ga0466967_0143275
317 Ga0466967_0170278
318 Ga0466967_0212705
319 Ga0466967_2193023
320 Ga0495641_0038077
321 Ga0495608_0368248
322 Ga0495618_0420546
323 Ga0495630_0124298
324 Ga0495587_0132427
325 Ga0495587_0267906
326 Ga0495645_0305426
327 Ga0495667_0161439
328 Ga0495635_0158412
329 Ga0495657_0562031
330 Ga0495581_0095874
331 Ga0495604_0965826
332 Ga0496101_0120771
333 Ga0496102_0059517
334 Ga0496102_0938038
335 Ga0496107_0463983
336 Ga0496107_0763795
337 Ga0496109_1779616
338 Ga0496110_0710106
339 Ga0496111_0220004
340 Ga0496114_0085284
341 Ga0496114_0087350
342 Ga0496114_1689529
343 Ga0496115_0880915
344 Ga0501034_0000257
345 Ga0501070_0086074
346 nmdc:mga00v17_104919_c1
347 nmdc:mga00v17_444743_c1
348 nmdc:mga0yw44_168213_c1
349 nmdc:mga0yw44_421207_c1
350 nmdc:mga04h51_245206_c1
351 nmdc:mga0qj67_328153_c1
352 Ga0500635_0011287
353 Ga0495595_0291031
354 Ga0500643_000369
355 Ga0500583_0357089
356 Ga0500628_027630
357 Ga0500568_0170088
358 Ga0500616_0000141
359 Ga0500616_0000889
360 Ga0466962_0091017
361 Ga0466962_0476223
362 2729905576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

27

112

0.96

PF12900

Pyridox_ox_2

Pyridoxamine 5'-phosphate oxidase

28

148

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jab-assembly1.cif.gz_B structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.9601 5 127
5jab-assembly2.cif.gz_D structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.9526 1 127
5jab-assembly2.cif.gz_D structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.9453 1 127
2iab-assembly1.cif.gz_A crystal structure of a protein with fmn-binding split barrel fold (np_828636.1) from streptomyces avermitilis at 2.00 a resolution 0.8164 9 126
7kpz-assembly1.cif.gz_A 1.70 a resolution crystal structure of group a streptococcus hupz-v5-his6 0.8158 5 125
ID Description Score Start End Superfamily
2asfA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9635 7 127 2.30.110.10
2asfA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9256 7 127 2.30.110.10
af_O53240_10_156_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8376 4 125 2.30.110.10
af_Q5AGF9_5_181_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8141 4 125 2.30.110.10
1rfeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8061 6 125 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A6J6VN84-F1-model_v4 Unannotated protein 0.9959 48 127
AF-L8DI89-F1-model_v4 Putative pyridoxal 5'-phosphate oxidase 0.9916 7 126 GO:0005829
GO:0016627
GO:0070967
AF-A0A3D9UB48-F1-model_v4 deleted 0.9887 6 126
AF-A0A7X9KGS1-F1-model_v4 TIGR03618 family F420-dependent PPOX class oxidoreductase 0.988 4 125 GO:0005829
GO:0016627
GO:0070967
AF-A0A2S6IVW8-F1-model_v4 PPOX class probable F420-dependent enzyme 0.987 5 125 GO:0005829
GO:0016627
GO:0070967

Map