F277951

General Info

Members Datasets Scaffolds Average Seq Length
181 112 362 186

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0355538|Ga0495630_0355538_346_921
Length 191
Sequence MSSTTDLAPTSPNLTGAYTIDPTHSRIGFIARHAMVTKVRGSFNEFEGSGYFDAENPSASKVDLTIQAASIDTRNADRDGHLRSNDFFDMETYPEISFSSTGVEVVGDEYRVTGDLTIKGVTKPVTVDFEYTGTAIDPYNNTRVGFEGTTTVNRKDWGVSWNAPLEAGGVLVGEKIVLEFEISAIRAVDNV

Samples

Sample ID Description Type Environment
1 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
17 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
21 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
23 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
24 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
28 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
37 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
38 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
39 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
40 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
41 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
42 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
43 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
44 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
45 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
46 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
47 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
48 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
49 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
50 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
51 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
52 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
53 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
54 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
55 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
56 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
57 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
58 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
59 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
60 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
61 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
62 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
92 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
93 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
94 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
95 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
96 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
97 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
98 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
103 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
104 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
105 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
106 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
107 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
108 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
109 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
110 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
111 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
112 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 55.8
Metatranscriptomes 43.65
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.31
Nodule 0
Rhizoplane 0.55
Rhizosphere 93.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495630_0355538 3300046517 Bacteria 1121
2 Ga0006778J45830_1013419 3300003162 Bacteria 629
3 Ga0006778J45830_1100206 3300003162 Bacteria 616
4 Ga0006759J45824_1065752 3300003163 Bacteria 609
5 Ga0006777J48905_1020839 3300003308 Bacteria 626
6 Ga0007410J51695_1029315 3300003574 Bacteria 616
7 Ga0007409J51694_1052165 3300003575 Bacteria 610
8 Ga0058861_12037626 3300004800 Bacteria 655
9 Ga0070661_100074804 3300005344 Bacteria 2495
10 Ga0070659_100430918 3300005366 Bacteria 1116
11 Ga0081455_10037851 3300005937 Bacteria 4276
12 Ga0081455_10071756 3300005937 Bacteria 2869
13 Ga0081455_10351470 3300005937 Bacteria 1039
14 Ga0081538_10045679 3300005981 Bacteria 2712
15 Ga0075365_10186697 3300006038 Bacteria 1450
16 Ga0075363_100194412 3300006048 Bacteria 1158
17 Ga0075364_10173733 3300006051 Bacteria 1457
18 Ga0075428_100591387 3300006844 Bacteria 1185
19 Ga0075429_100588924 3300006880 Bacteria 974
20 Ga0075435_100824137 3300007076 Bacteria 808
21 Ga0111539_10041239 3300009094 Bacteria 5550
22 Ga0111539_10049549 3300009094 Bacteria 5007
23 Ga0111539_10066821 3300009094 Bacteria 4247
24 Ga0114129_11006222 3300009147 Bacteria 1049
25 Ga0114129_11243932 3300009147 Bacteria 925
26 Ga0197907_10431382 3300020069 Bacteria 874
27 Ga0197907_11113816 3300020069 Bacteria 625
28 Ga0206356_10584764 3300020070 Bacteria 921
29 Ga0206356_11080170 3300020070 Bacteria 653
30 Ga0206349_1164722 3300020075 Bacteria 811
31 Ga0206355_1279344 3300020076 Bacteria 743
32 Ga0206355_1295738 3300020076 Bacteria 1215
33 Ga0206355_1431580 3300020076 Bacteria 742
34 Ga0206355_1643171 3300020076 Bacteria 660
35 Ga0206352_10520744 3300020078 Bacteria 699
36 Ga0206352_10638879 3300020078 Bacteria 1083
37 Ga0206354_10571207 3300020081 Bacteria 609
38 Ga0206354_10662203 3300020081 Bacteria 1213
39 Ga0206354_10753545 3300020081 Bacteria 1116
40 Ga0206354_11293714 3300020081 Bacteria 985
41 Ga0206354_11489099 3300020081 Bacteria 674
42 Ga0206353_11031663 3300020082 Bacteria 800
43 Ga0206353_11366292 3300020082 Bacteria 840
44 Ga0206353_11414543 3300020082 Bacteria 986
45 Ga0154015_1078540 3300020610 Bacteria 792
46 Ga0154015_1163997 3300020610 Bacteria 653
47 Ga0154015_1230524 3300020610 Bacteria 702
48 Ga0224712_10382426 3300022467 Bacteria 669
49 Ga0207660_10821704 3300025917 Bacteria 758
50 Ga0207649_10391031 3300025920 Bacteria 1038
51 Ga0207690_10440821 3300025932 Bacteria 1045
52 Ga0207689_10389211 3300025942 Bacteria 1161
53 Ga0207667_10223967 3300025949 Bacteria 1927
54 Ga0207683_10645171 3300026121 Bacteria 981
55 Ga0209974_10025406 3300027876 Bacteria 1960
56 Ga0207428_10028992 3300027907 Bacteria 4593
57 Ga0307410_10047277 3300031852 Bacteria 2875
58 Ga0307406_11196943 3300031901 Bacteria 660
59 Ga0307407_10098990 3300031903 Bacteria 1805
60 Ga0307409_100010813 3300031995 Bacteria 5706
61 Ga0307411_10011500 3300032005 Bacteria 4781
62 Ga0373931_0118224 3300035691 Bacteria 1512
63 Ga0436364_0912410 3300037853 Bacteria 3514
64 Ga0436363_0159842 3300039450 Bacteria 1018
65 Ga0451797_0883162 3300041453 Bacteria 1076
66 Ga0451843_1552862 3300041509 Bacteria 1024
67 Ga0439460_0079582 3300042461 Bacteria 1027
68 Ga0466961_0086225 3300044693 Bacteria 1985
69 Ga0466961_0155235 3300044693 Bacteria 1428
70 Ga0466959_0201386 3300045049 Bacteria 1386
71 Ga0466967_0023133 3300045976 Bacteria 5088
72 Ga0495641_0128877 3300046461 Bacteria 1129
73 Ga0495594_0521957 3300046499 Bacteria 674
74 Ga0495583_0089522 3300046506 Bacteria 1327
75 Ga0495628_0001487 3300046516 Bacteria 21466
76 Ga0495640_0094577 3300046533 Bacteria 1968
77 Ga0495657_0098447 3300046675 Bacteria 1866
78 Ga0495658_0021351 3300046683 Bacteria 3412
79 Ga0495649_0389093 3300046694 Bacteria 701
80 Ga0495674_0062740 3300047319 Bacteria 3235
81 Ga0495676_0131932 3300047321 Bacteria 1802
82 Ga0495680_0217809 3300047322 Bacteria 1364
83 Ga0501306_004516 3300049127 Bacteria 1562
84 Ga0501306_024643 3300049127 Bacteria 861
85 Ga0501306_035038 3300049127 Bacteria 760
86 Ga0501308_016014 3300049128 Bacteria 893
87 Ga0501308_020271 3300049128 Bacteria 826
88 Ga0501308_041791 3300049128 Bacteria 648
89 Ga0501308_051838 3300049128 Bacteria 602
90 Ga0501309_010643 3300049129 Bacteria 1188
91 Ga0501309_051545 3300049129 Bacteria 647
92 Ga0501309_054204 3300049129 Bacteria 635
93 Ga0501309_059083 3300049129 Bacteria 614
94 Ga0501310_023256 3300049130 Bacteria 787
95 Ga0501310_032008 3300049130 Bacteria 702
96 Ga0501310_046071 3300049130 Bacteria 620
97 Ga0501304_005390 3300049160 Bacteria 1001
98 Ga0501304_027148 3300049160 Bacteria 594
99 Ga0501305_009284 3300049161 Bacteria 1290
100 Ga0501305_022365 3300049161 Bacteria 940
101 Ga0501305_025651 3300049161 Bacteria 895
102 Ga0501307_004856 3300049162 Bacteria 1394
103 Ga0501307_025943 3300049162 Bacteria 790
104 Ga0501311_042240 3300049527 Bacteria 694
105 Ga0501312_013890 3300049528 Bacteria 1126
106 Ga0501312_033120 3300049528 Bacteria 819
107 Ga0501312_057140 3300049528 Bacteria 669
108 Ga0501312_064166 3300049528 Bacteria 641
109 Ga0501313_030887 3300049529 Bacteria 694
110 Ga0501313_046604 3300049529 Bacteria 592
111 Ga0501314_021709 3300049530 Bacteria 671
112 Ga0501314_029099 3300049530 Bacteria 607
113 Ga0501315_008897 3300049531 Bacteria 1177
114 Ga0501315_015358 3300049531 Bacteria 980
115 Ga0501315_040830 3300049531 Bacteria 702
116 Ga0501316_012743 3300049532 Bacteria 986
117 Ga0501316_049330 3300049532 Bacteria 603
118 Ga0501317_016806 3300049533 Bacteria 953
119 Ga0501317_024105 3300049533 Bacteria 844
120 Ga0501318_007163 3300049534 Bacteria 1158
121 Ga0501318_012660 3300049534 Bacteria 970
122 Ga0501318_022470 3300049534 Bacteria 809
123 Ga0501318_051253 3300049534 Bacteria 614
124 Ga0501319_018643 3300049535 Bacteria 609
125 Ga0501320_028126 3300049536 Bacteria 687
126 Ga0501321_001447 3300049537 Bacteria 1888
127 Ga0501321_006099 3300049537 Bacteria 1214
128 Ga0501321_023620 3300049537 Bacteria 781
129 Ga0501321_028875 3300049537 Bacteria 731
130 Ga0501322_006589 3300049538 Bacteria 829
131 Ga0501325_017921 3300049541 Bacteria 721
132 Ga0501031_0075788 3300049568 Bacteria 2190
133 Ga0501031_0353398 3300049568 Bacteria 951
134 Ga0501033_0084966 3300049570 Bacteria 2319
135 Ga0501036_0023664 3300049572 Bacteria 5176
136 Ga0501040_0370834 3300049576 Bacteria 1026
137 Ga0501040_0695715 3300049576 Bacteria 735
138 Ga0501042_0091436 3300049578 Bacteria 2184
139 Ga0501043_0649184 3300049579 Bacteria 775
140 Ga0501043_0857664 3300049579 Bacteria 654
141 Ga0501046_0003350 3300049580 Bacteria 14712
142 Ga0501046_0604768 3300049580 Bacteria 778
143 Ga0501047_1144439 3300049581 Bacteria 592
144 Ga0501048_0155635 3300049582 Bacteria 1617
145 Ga0501069_0000034 3300049585 Bacteria 92080
146 Ga0501070_0000013 3300049586 Bacteria 180554
147 Ga0501071_0010100 3300049587 Bacteria 6313
148 Ga0501071_0012589 3300049587 Bacteria 5744
149 Ga0501071_0066062 3300049587 Bacteria 2628
150 Ga0501071_0528841 3300049587 Bacteria 905
151 Ga0501072_0025326 3300049588 Bacteria 4621
152 Ga0501072_0415486 3300049588 Bacteria 1066
153 Ga0501075_0140621 3300049591 Bacteria 1839
154 Ga0501076_0032254 3300049592 Bacteria 4087
155 Ga0501076_0109074 3300049592 Bacteria 2237
156 Ga0501076_0557592 3300049592 Bacteria 945
157 Ga0501076_0746155 3300049592 Bacteria 808
158 Ga0501077_0039382 3300049593 Bacteria 3011
159 Ga0501079_0002072 3300049741 Bacteria 14374
160 Ga0501080_0005545 3300049742 Bacteria 11268
161 Ga0501080_0134031 3300049742 Bacteria 2293
162 Ga0501080_1284731 3300049742 Bacteria 627
163 Ga0501035_0402325 3300049822 Bacteria 1139
164 Ga0501044_0251861 3300049823 Bacteria 1707
165 Ga0501045_0031208 3300049824 Bacteria 3859
166 Ga0501045_0154670 3300049824 Bacteria 1706
167 nmdc:mga03n38_506731_c1 3300050490 Bacteria 678
168 nmdc:mga00v17_201129_c1 3300050491 Bacteria 1288
169 nmdc:mga00v17_63677_c1 3300050491 Bacteria 2271
170 nmdc:mga05p37_140705_c1 3300050507 Bacteria 2957
171 nmdc:mga05p37_757045_c1 3300050507 Bacteria 1070
172 nmdc:mga06r32_12461_c1 3300050510 Bacteria 7674
173 nmdc:mga06r32_1792072_c1 3300050510 Bacteria 550
174 nmdc:mga08y16_842060_c1 3300050511 Bacteria 907
175 nmdc:mga08y16_87695_c1 3300050511 Bacteria 3242
176 Ga0495595_0017495 3300053084 Bacteria 3084
177 Ga0501084_0035750 3300054114 Bacteria 4152
178 Ga0501084_0224525 3300054114 Bacteria 1585
179 Ga0501082_0176289 3300060353 Bacteria 1859
180 Ga0530510_0109261 3300061734 Bacteria 2025
181 2837185800 2837183177 Bacteria 4637169
182 Ga0495630_0355538
183 Ga0006778J45830_1013419
184 Ga0006778J45830_1100206
185 Ga0006759J45824_1065752
186 Ga0006777J48905_1020839
187 Ga0007410J51695_1029315
188 Ga0007409J51694_1052165
189 Ga0058861_12037626
190 Ga0070661_100074804
191 Ga0070659_100430918
192 Ga0081455_10037851
193 Ga0081455_10071756
194 Ga0081455_10351470
195 Ga0081538_10045679
196 Ga0075365_10186697
197 Ga0075363_100194412
198 Ga0075364_10173733
199 Ga0075428_100591387
200 Ga0075429_100588924
201 Ga0075435_100824137
202 Ga0111539_10041239
203 Ga0111539_10049549
204 Ga0111539_10066821
205 Ga0114129_11006222
206 Ga0114129_11243932
207 Ga0197907_10431382
208 Ga0197907_11113816
209 Ga0206356_10584764
210 Ga0206356_11080170
211 Ga0206349_1164722
212 Ga0206355_1279344
213 Ga0206355_1295738
214 Ga0206355_1431580
215 Ga0206355_1643171
216 Ga0206352_10520744
217 Ga0206352_10638879
218 Ga0206354_10571207
219 Ga0206354_10662203
220 Ga0206354_10753545
221 Ga0206354_11293714
222 Ga0206354_11489099
223 Ga0206353_11031663
224 Ga0206353_11366292
225 Ga0206353_11414543
226 Ga0154015_1078540
227 Ga0154015_1163997
228 Ga0154015_1230524
229 Ga0224712_10382426
230 Ga0207660_10821704
231 Ga0207649_10391031
232 Ga0207690_10440821
233 Ga0207689_10389211
234 Ga0207667_10223967
235 Ga0207683_10645171
236 Ga0209974_10025406
237 Ga0207428_10028992
238 Ga0307410_10047277
239 Ga0307406_11196943
240 Ga0307407_10098990
241 Ga0307409_100010813
242 Ga0307411_10011500
243 Ga0373931_0118224
244 Ga0436364_0912410
245 Ga0436363_0159842
246 Ga0451797_0883162
247 Ga0451843_1552862
248 Ga0439460_0079582
249 Ga0466961_0086225
250 Ga0466961_0155235
251 Ga0466959_0201386
252 Ga0466967_0023133
253 Ga0495641_0128877
254 Ga0495594_0521957
255 Ga0495583_0089522
256 Ga0495628_0001487
257 Ga0495640_0094577
258 Ga0495657_0098447
259 Ga0495658_0021351
260 Ga0495649_0389093
261 Ga0495674_0062740
262 Ga0495676_0131932
263 Ga0495680_0217809
264 Ga0501306_004516
265 Ga0501306_024643
266 Ga0501306_035038
267 Ga0501308_016014
268 Ga0501308_020271
269 Ga0501308_041791
270 Ga0501308_051838
271 Ga0501309_010643
272 Ga0501309_051545
273 Ga0501309_054204
274 Ga0501309_059083
275 Ga0501310_023256
276 Ga0501310_032008
277 Ga0501310_046071
278 Ga0501304_005390
279 Ga0501304_027148
280 Ga0501305_009284
281 Ga0501305_022365
282 Ga0501305_025651
283 Ga0501307_004856
284 Ga0501307_025943
285 Ga0501311_042240
286 Ga0501312_013890
287 Ga0501312_033120
288 Ga0501312_057140
289 Ga0501312_064166
290 Ga0501313_030887
291 Ga0501313_046604
292 Ga0501314_021709
293 Ga0501314_029099
294 Ga0501315_008897
295 Ga0501315_015358
296 Ga0501315_040830
297 Ga0501316_012743
298 Ga0501316_049330
299 Ga0501317_016806
300 Ga0501317_024105
301 Ga0501318_007163
302 Ga0501318_012660
303 Ga0501318_022470
304 Ga0501318_051253
305 Ga0501319_018643
306 Ga0501320_028126
307 Ga0501321_001447
308 Ga0501321_006099
309 Ga0501321_023620
310 Ga0501321_028875
311 Ga0501322_006589
312 Ga0501325_017921
313 Ga0501031_0075788
314 Ga0501031_0353398
315 Ga0501033_0084966
316 Ga0501036_0023664
317 Ga0501040_0370834
318 Ga0501040_0695715
319 Ga0501042_0091436
320 Ga0501043_0649184
321 Ga0501043_0857664
322 Ga0501046_0003350
323 Ga0501046_0604768
324 Ga0501047_1144439
325 Ga0501048_0155635
326 Ga0501069_0000034
327 Ga0501070_0000013
328 Ga0501071_0010100
329 Ga0501071_0012589
330 Ga0501071_0066062
331 Ga0501071_0528841
332 Ga0501072_0025326
333 Ga0501072_0415486
334 Ga0501075_0140621
335 Ga0501076_0032254
336 Ga0501076_0109074
337 Ga0501076_0557592
338 Ga0501076_0746155
339 Ga0501077_0039382
340 Ga0501079_0002072
341 Ga0501080_0005545
342 Ga0501080_0134031
343 Ga0501080_1284731
344 Ga0501035_0402325
345 Ga0501044_0251861
346 Ga0501045_0031208
347 Ga0501045_0154670
348 nmdc:mga03n38_506731_c1
349 nmdc:mga00v17_201129_c1
350 nmdc:mga00v17_63677_c1
351 nmdc:mga05p37_140705_c1
352 nmdc:mga05p37_757045_c1
353 nmdc:mga06r32_12461_c1
354 nmdc:mga06r32_1792072_c1
355 nmdc:mga08y16_842060_c1
356 nmdc:mga08y16_87695_c1
357 Ga0495595_0017495
358 Ga0501084_0035750
359 Ga0501084_0224525
360 Ga0501082_0176289
361 Ga0530510_0109261
362 2837185800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

18

184

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9216 13 185
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9164 13 185
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.9157 17 181
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.9048 13 186
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.8997 13 186
ID Description Score Start End Superfamily
af_O53630_1_69_3.10.600.10 Alpha Beta;Roll;pyruvate carboxylase f1077a mutant fold;pyruvate carboxylase f1077a mutant domain 0.9132 94 128 3.10.600.10
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9082 13 186 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9031 13 186 2.40.128.110
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8888 14 186 2.40.128.110
5w2dA01 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8887 36 186 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A231P790-F1-model_v4 Polyisoprenoid-binding protein 0.9649 2 186
AF-A0A231P790-F1-model_v4 Polyisoprenoid-binding protein 0.9596 2 186
AF-A0A850D6W1-F1-model_v4 deleted 0.9494 1 154
AF-A0A3D0TZE2-F1-model_v4 YceI family protein 0.9446 36 185
AF-A0A2S4ZTN4-F1-model_v4 Polyisoprenoid-binding protein 0.9435 9 186

Map