F277883

General Info

Members Datasets Scaffolds Average Seq Length
181 131 362 285

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0521879|Ga0466967_0521879_57_1043
Length 328
Sequence MSAHRSRFLNGVSMVLTWTWTVVPVSPGVVTAATLADTGARPTARSGAALALASMLCVQLGLAVSVGLFDRVGPEGAAWLRLAWAGVLLLVVVRPRPSAFSRTGLLACVALGVVTAGLTLFFMAAVARLPLGTASALEFLGPLGVAVVRGGRRGLWWPALAAAGVVLLTEPWRGGADPVGVAFALAAAVCWAAYILLTQRVGDEVAGLRGLAVSMPVAGVVTTVAVGPSVVGHLTPEVLLIGLGLAVLLPVVPFSLELLALRRLTSAAFGTLMSLEPAIALVVGAVLLHQVPGAAALVGVAFVVAAGVGAQRTGARDEAPASSTGRCG

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
68 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
69 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
70 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
71 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
72 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
80 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
81 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
82 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
83 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
84 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
85 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
86 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
87 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
92 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
101 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
102 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
103 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
104 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
105 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
106 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
107 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
108 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
109 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
114 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
117 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
121 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
122 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
123 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
124 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
125 2643221641 Nocardioides sp. Root122 Isolate Unclassified
126 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
127 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
128 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
129 2858868258 Micromonospora sp. MH33 Isolate Unclassified
130 2902582711 Micromonospora sp. AP08 Isolate Unclassified
131 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.13
Metatranscriptomes 0
Isolates 3.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.15
Nodule 0.55
Rhizoplane 20.44
Rhizosphere 55.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0521879 3300045976 Bacteria 1167
2 Ga0055540_1000036 3300003792 Bacteria 164285
3 Ga0055540_1001265 3300003792 Bacteria 15402
4 Ga0055540_1001769 3300003792 Bacteria 12322
5 Ga0055540_1005936 3300003792 Bacteria 4972
6 Ga0070676_10087464 3300005328 Bacteria 1902
7 Ga0070683_100093044 3300005329 Bacteria 2831
8 Ga0070683_100369134 3300005329 Bacteria 1367
9 Ga0070670_100702776 3300005331 Bacteria 909
10 Ga0068869_100346017 3300005334 Bacteria 1211
11 Ga0068868_100005571 3300005338 Bacteria 8856
12 Ga0068868_100176035 3300005338 Bacteria 1773
13 Ga0070660_100259750 3300005339 Bacteria 1418
14 Ga0070661_100017761 3300005344 Bacteria 5050
15 Ga0070692_10024696 3300005345 Bacteria 2956
16 Ga0070668_100015363 3300005347 Bacteria 5722
17 Ga0070674_100145027 3300005356 Bacteria 1786
18 Ga0070667_100003336 3300005367 Bacteria 13714
19 Ga0070714_100237353 3300005435 Bacteria 1682
20 Ga0070700_100013884 3300005441 Bacteria 4534
21 Ga0070663_100000090 3300005455 Bacteria 41066
22 Ga0070663_100051387 3300005455 Bacteria 2936
23 Ga0070663_100269513 3300005455 Bacteria 1353
24 Ga0070678_100113881 3300005456 Bacteria 2121
25 Ga0070678_100300477 3300005456 Bacteria 1364
26 Ga0070662_100211357 3300005457 Bacteria 1544
27 Ga0070684_100492362 3300005535 Bacteria 1135
28 Ga0070664_100005665 3300005564 Bacteria 10056
29 Ga0068857_100050162 3300005577 Bacteria 3703
30 Ga0068854_100396766 3300005578 Bacteria 1140
31 Ga0068856_100226046 3300005614 Bacteria 1887
32 Ga0070702_100029552 3300005615 Bacteria 2982
33 Ga0068862_100005976 3300005844 Bacteria 10133
34 Ga0081539_10008298 3300005985 Bacteria 9098
35 Ga0075365_10005584 3300006038 Bacteria 6801
36 Ga0075365_10062938 3300006038 Bacteria 2483
37 Ga0075365_10167697 3300006038 Bacteria 1532
38 Ga0075364_10003429 3300006051 Bacteria 9010
39 Ga0075364_10133706 3300006051 Bacteria 1666
40 Ga0075364_10158116 3300006051 Bacteria 1529
41 Ga0075369_10007759 3300006186 Bacteria 4104
42 Ga0075431_100002396 3300006847 Bacteria 18033
43 Ga0111539_10000628 3300009094 Bacteria 45672
44 Ga0111539_10384092 3300009094 Bacteria 1635
45 Ga0105245_10064289 3300009098 Bacteria 3315
46 Ga0105248_10037831 3300009177 Bacteria 5399
47 Ga0157372_10037587 3300013307 Bacteria 5342
48 Ga0157375_10228097 3300013308 Bacteria 2021
49 Ga0157375_10492894 3300013308 Bacteria 1390
50 Ga0157375_10704283 3300013308 Bacteria 1163
51 Ga0157377_10002902 3300014745 Bacteria 7667
52 Ga0157379_10298715 3300014968 Bacteria 1467
53 Ga0209051_1000021 3300025303 Bacteria 507633
54 Ga0209051_1000652 3300025303 Bacteria 39235
55 Ga0209051_1001454 3300025303 Bacteria 20087
56 Ga0209051_1017078 3300025303 Bacteria 3255
57 Ga0207688_10029377 3300025901 Bacteria 3026
58 Ga0207645_10033483 3300025907 Bacteria 3302
59 Ga0207643_10096728 3300025908 Bacteria 1727
60 Ga0207657_10228529 3300025919 Bacteria 1489
61 Ga0207649_10032368 3300025920 Bacteria 3117
62 Ga0207687_10196617 3300025927 Bacteria 1573
63 Ga0207706_10008993 3300025933 Bacteria 9193
64 Ga0207711_10391077 3300025941 Bacteria 1291
65 Ga0207689_10031707 3300025942 Bacteria 4397
66 Ga0207689_10090977 3300025942 Bacteria 2507
67 Ga0207689_10127756 3300025942 Bacteria 2091
68 Ga0207661_10008909 3300025944 Bacteria 7185
69 Ga0207661_10424011 3300025944 Bacteria 1209
70 Ga0207668_10008233 3300025972 Bacteria 6213
71 Ga0207640_10282932 3300025981 Bacteria 1303
72 Ga0207658_10000611 3300025986 Bacteria 31714
73 Ga0207677_10095516 3300026023 Bacteria 2173
74 Ga0207678_10000390 3300026067 Bacteria 39978
75 Ga0207678_10025166 3300026067 Bacteria 5196
76 Ga0207648_10248614 3300026089 Bacteria 1585
77 Ga0207676_10286297 3300026095 Bacteria 1498
78 Ga0207674_10056101 3300026116 Bacteria 4002
79 Ga0207683_10022408 3300026121 Bacteria 5422
80 Ga0207428_10047064 3300027907 Bacteria 3465
81 Ga0268265_10175297 3300028380 Bacteria 1837
82 Ga0265327_10005022 3300031251 Bacteria 11323
83 Ga0307513_10043156 3300031456 Bacteria 4957
84 Ga0307509_10202669 3300031507 Bacteria 1819
85 Ga0307406_10071707 3300031901 Bacteria 2271
86 Ga0307407_10002149 3300031903 Bacteria 7579
87 Ga0307409_100009037 3300031995 Bacteria 6095
88 Ga0307414_10032494 3300032004 Bacteria 3437
89 Ga0451791_0720764 3300041451 Bacteria 4434
90 Ga0451798_0898873 3300041458 Bacteria 1043
91 Ga0451841_0002724 3300041498 Bacteria 1418
92 Ga0451843_0223086 3300041509 Bacteria 3252
93 Ga0439448_0016315 3300042005 Bacteria 2259
94 Ga0466972_0028561 3300044658 Bacteria 2750
95 Ga0466965_0002898 3300044683 Bacteria 7408
96 Ga0466965_0005902 3300044683 Bacteria 5529
97 Ga0466961_0291426 3300044693 Bacteria 998
98 Ga0466970_0176813 3300044765 Bacteria 1184
99 Ga0466957_0060173 3300044842 Bacteria 2329
100 Ga0466960_0000480 3300044901 Bacteria 13641
101 Ga0466967_0089141 3300045976 Bacteria 2801
102 Ga0466967_0158960 3300045976 Bacteria 2120
103 Ga0466967_0317006 3300045976 Bacteria 1503
104 Ga0495629_0103963 3300046459 Bacteria 1981
105 Ga0495629_0142966 3300046459 Bacteria 1664
106 Ga0495638_0004986 3300046460 Bacteria 9958
107 Ga0495608_0291035 3300046511 Bacteria 1012
108 Ga0495620_0060863 3300046515 Bacteria 1573
109 Ga0495631_0067690 3300046518 Bacteria 1545
110 Ga0495635_0076554 3300046663 Bacteria 2293
111 Ga0495658_0265507 3300046683 Bacteria 1081
112 Ga0495626_0059254 3300048091 Bacteria 1747
113 Ga0496100_0000011 3300048903 Bacteria 190969
114 Ga0496100_0001144 3300048903 Bacteria 12885
115 Ga0496100_0022183 3300048903 Bacteria 3839
116 Ga0496101_0000017 3300048904 Bacteria 239153
117 Ga0496101_0001860 3300048904 Bacteria 12739
118 Ga0496102_0033328 3300048905 Bacteria 4627
119 Ga0496102_0040104 3300048905 Bacteria 4234
120 Ga0496102_0218605 3300048905 Bacteria 1796
121 Ga0496103_0000388 3300048906 Bacteria 39328
122 Ga0496103_0179364 3300048906 Bacteria 1361
123 Ga0496104_0035752 3300048907 Bacteria 4640
124 Ga0496106_0002430 3300048909 Bacteria 13872
125 Ga0496106_0009820 3300048909 Bacteria 7067
126 Ga0496106_0034530 3300048909 Bacteria 3778
127 Ga0496107_0000597 3300048910 Bacteria 20152
128 Ga0496107_0015094 3300048910 Bacteria 5412
129 Ga0496108_0003026 3300048911 Bacteria 13520
130 Ga0496108_0055672 3300048911 Bacteria 3321
131 Ga0496108_0180478 3300048911 Bacteria 1828
132 Ga0496108_0507246 3300048911 Bacteria 1053
133 Ga0496109_0000041 3300048912 Bacteria 141346
134 Ga0496109_0142530 3300048912 Bacteria 2241
135 Ga0496110_0003323 3300048913 Bacteria 12285
136 Ga0496110_0122238 3300048913 Bacteria 2346
137 Ga0496111_0004719 3300048914 Bacteria 8648
138 Ga0496112_0061063 3300048915 Bacteria 3715
139 Ga0496114_0000089 3300048917 Bacteria 65037
140 Ga0496114_0034159 3300048917 Bacteria 4194
141 Ga0496114_0038537 3300048917 Bacteria 3955
142 Ga0496114_0380740 3300048917 Bacteria 1249
143 Ga0496114_0449605 3300048917 Bacteria 1141
144 Ga0496114_0461502 3300048917 Bacteria 1124
145 Ga0496115_0001738 3300048918 Bacteria 15624
146 Ga0496115_0005463 3300048918 Bacteria 9245
147 Ga0496115_0165469 3300048918 Bacteria 1829
148 Ga0496116_0016990 3300048919 Bacteria 5668
149 Ga0496117_0034440 3300048920 Bacteria 3814
150 Ga0496118_0015947 3300048921 Bacteria 6922
151 Ga0496119_0000539 3300048922 Bacteria 51578
152 Ga0496120_0033372 3300048923 Bacteria 3093
153 Ga0496121_0000014 3300048924 Bacteria 609379
154 Ga0496122_0000084 3300048925 Bacteria 208740
155 Ga0496124_0000019 3300048927 Bacteria 436995
156 Ga0496125_0000014 3300048928 Bacteria 610124
157 Ga0496126_0000017 3300048929 Bacteria 610676
158 Ga0501033_0416363 3300049570 Bacteria 936
159 Ga0501036_0141998 3300049572 Bacteria 2026
160 Ga0501048_0161455 3300049582 Bacteria 1586
161 Ga0501067_0017173 3300049583 Bacteria 4000
162 Ga0501068_0270526 3300049584 Bacteria 1085
163 Ga0501044_0036041 3300049823 Bacteria 5177
164 nmdc:mga00v17_192131_c1 3300050491 Bacteria 1319
165 nmdc:mga00v17_250847_c1 3300050491 Bacteria 1147
166 nmdc:mga00v17_66009_c1 3300050491 Bacteria 2233
167 nmdc:mga0yw44_56586_c1 3300050492 Bacteria 2390
168 nmdc:mga06r32_29761_c1 3300050510 Bacteria 5122
169 nmdc:mga08y16_24886_c1 3300050511 Bacteria 6315
170 nmdc:mga0sz30_26442_c1 3300050516 Bacteria 2378
171 Ga0495601_0248219 3300053077 Bacteria 1162
172 Ga0500610_0046477 3300053079 Bacteria 2254
173 Ga0500644_0115603 3300053088 Bacteria 1039
174 Ga0466962_0171326 3300061719 Bacteria 1057
175 2644230836 2643221641 Bacteria 4490190
176 2644485816 2643221687 Bacteria 6500351
177 2644633925 2643221715 Bacteria 6671032
178 2842137849 2842134933 Bacteria 5847019
179 2858870128 2858868258 Bacteria 7683772
180 2902587390 2902582711 Bacteria 6187705
181 2902843608 2902837492 Bacteria 6697721
182 Ga0466967_0521879
183 Ga0055540_1000036
184 Ga0055540_1001265
185 Ga0055540_1001769
186 Ga0055540_1005936
187 Ga0070676_10087464
188 Ga0070683_100093044
189 Ga0070683_100369134
190 Ga0070670_100702776
191 Ga0068869_100346017
192 Ga0068868_100005571
193 Ga0068868_100176035
194 Ga0070660_100259750
195 Ga0070661_100017761
196 Ga0070692_10024696
197 Ga0070668_100015363
198 Ga0070674_100145027
199 Ga0070667_100003336
200 Ga0070714_100237353
201 Ga0070700_100013884
202 Ga0070663_100000090
203 Ga0070663_100051387
204 Ga0070663_100269513
205 Ga0070678_100113881
206 Ga0070678_100300477
207 Ga0070662_100211357
208 Ga0070684_100492362
209 Ga0070664_100005665
210 Ga0068857_100050162
211 Ga0068854_100396766
212 Ga0068856_100226046
213 Ga0070702_100029552
214 Ga0068862_100005976
215 Ga0081539_10008298
216 Ga0075365_10005584
217 Ga0075365_10062938
218 Ga0075365_10167697
219 Ga0075364_10003429
220 Ga0075364_10133706
221 Ga0075364_10158116
222 Ga0075369_10007759
223 Ga0075431_100002396
224 Ga0111539_10000628
225 Ga0111539_10384092
226 Ga0105245_10064289
227 Ga0105248_10037831
228 Ga0157372_10037587
229 Ga0157375_10228097
230 Ga0157375_10492894
231 Ga0157375_10704283
232 Ga0157377_10002902
233 Ga0157379_10298715
234 Ga0209051_1000021
235 Ga0209051_1000652
236 Ga0209051_1001454
237 Ga0209051_1017078
238 Ga0207688_10029377
239 Ga0207645_10033483
240 Ga0207643_10096728
241 Ga0207657_10228529
242 Ga0207649_10032368
243 Ga0207687_10196617
244 Ga0207706_10008993
245 Ga0207711_10391077
246 Ga0207689_10031707
247 Ga0207689_10090977
248 Ga0207689_10127756
249 Ga0207661_10008909
250 Ga0207661_10424011
251 Ga0207668_10008233
252 Ga0207640_10282932
253 Ga0207658_10000611
254 Ga0207677_10095516
255 Ga0207678_10000390
256 Ga0207678_10025166
257 Ga0207648_10248614
258 Ga0207676_10286297
259 Ga0207674_10056101
260 Ga0207683_10022408
261 Ga0207428_10047064
262 Ga0268265_10175297
263 Ga0265327_10005022
264 Ga0307513_10043156
265 Ga0307509_10202669
266 Ga0307406_10071707
267 Ga0307407_10002149
268 Ga0307409_100009037
269 Ga0307414_10032494
270 Ga0451791_0720764
271 Ga0451798_0898873
272 Ga0451841_0002724
273 Ga0451843_0223086
274 Ga0439448_0016315
275 Ga0466972_0028561
276 Ga0466965_0002898
277 Ga0466965_0005902
278 Ga0466961_0291426
279 Ga0466970_0176813
280 Ga0466957_0060173
281 Ga0466960_0000480
282 Ga0466967_0089141
283 Ga0466967_0158960
284 Ga0466967_0317006
285 Ga0495629_0103963
286 Ga0495629_0142966
287 Ga0495638_0004986
288 Ga0495608_0291035
289 Ga0495620_0060863
290 Ga0495631_0067690
291 Ga0495635_0076554
292 Ga0495658_0265507
293 Ga0495626_0059254
294 Ga0496100_0000011
295 Ga0496100_0001144
296 Ga0496100_0022183
297 Ga0496101_0000017
298 Ga0496101_0001860
299 Ga0496102_0033328
300 Ga0496102_0040104
301 Ga0496102_0218605
302 Ga0496103_0000388
303 Ga0496103_0179364
304 Ga0496104_0035752
305 Ga0496106_0002430
306 Ga0496106_0009820
307 Ga0496106_0034530
308 Ga0496107_0000597
309 Ga0496107_0015094
310 Ga0496108_0003026
311 Ga0496108_0055672
312 Ga0496108_0180478
313 Ga0496108_0507246
314 Ga0496109_0000041
315 Ga0496109_0142530
316 Ga0496110_0003323
317 Ga0496110_0122238
318 Ga0496111_0004719
319 Ga0496112_0061063
320 Ga0496114_0000089
321 Ga0496114_0034159
322 Ga0496114_0038537
323 Ga0496114_0380740
324 Ga0496114_0449605
325 Ga0496114_0461502
326 Ga0496115_0001738
327 Ga0496115_0005463
328 Ga0496115_0165469
329 Ga0496116_0016990
330 Ga0496117_0034440
331 Ga0496118_0015947
332 Ga0496119_0000539
333 Ga0496120_0033372
334 Ga0496121_0000014
335 Ga0496122_0000084
336 Ga0496124_0000019
337 Ga0496125_0000014
338 Ga0496126_0000017
339 Ga0501033_0416363
340 Ga0501036_0141998
341 Ga0501048_0161455
342 Ga0501067_0017173
343 Ga0501068_0270526
344 Ga0501044_0036041
345 nmdc:mga00v17_192131_c1
346 nmdc:mga00v17_250847_c1
347 nmdc:mga00v17_66009_c1
348 nmdc:mga0yw44_56586_c1
349 nmdc:mga06r32_29761_c1
350 nmdc:mga08y16_24886_c1
351 nmdc:mga0sz30_26442_c1
352 Ga0495601_0248219
353 Ga0500610_0046477
354 Ga0500644_0115603
355 Ga0466962_0171326
356 2644230836
357 2644485816
358 2644633925
359 2842137849
360 2858870128
361 2902587390
362 2902843608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

178

309

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.7723 4 255
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.7203 4 255
7b0k-assembly1.cif.gz_A membrane protein structure 0.7171 1 253
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7166 1 249
7b0k-assembly1.cif.gz_A membrane protein structure 0.7096 1 253
ID Description Score Start End Superfamily
af_Q47377_2_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8528 178 249 1.10.3730.20
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7355 1 255 1.20.1740.10
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6933 1 255 1.20.1740.10
af_Q8RWH8_5_118_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.6677 167 253 1.10.3730.20
af_I1MX93_4_118_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.6657 167 253 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A3S3AV60-F1-model_v4 EamA family transporter 0.9563 1 257 GO:0016020
AF-A0A4Y5W1X9-F1-model_v4 deleted 0.9393 2 254
AF-A0A438L050-F1-model_v4 deleted 0.939 2 252
AF-A0A285UHM2-F1-model_v4 Inner membrane transporter RhtA 0.9389 2 254 GO:0016020
AF-A0A1H9CM85-F1-model_v4 Inner membrane transporter RhtA 0.9386 2 253 GO:0016020

Map