F277858

General Info

Members Datasets Scaffolds Average Seq Length
181 73 180 182

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0228595|Ga0453684_0228595_299_853
Length 178
Sequence MTTYCDYCNSHPEDSYNRIYHDTEYGFPLTSDALLFERLILEINQAGLSWITILKKAENFRRAYGQFDIDAIAAARLLADAGIIRNRLKVNAAIENARRIQALRFEHGSFKGWLDDHHPLSLDEWAKLFKKTFVFTGGEIVKEFLMSSGYLPGAHTPDCPVYAGVMGQNPPWANSTSK

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
48 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
52 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
53 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
54 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
55 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
56 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
57 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
58 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
60 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
61 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
62 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
63 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
64 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
65 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
66 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
67 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
68 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
69 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
70 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
71 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
72 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
73 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_133186 2162886006 Bacteria 1133
2 SwRhRL2b_contig_2432529 2162886007 Bacteria 5229
3 JGI25406J46586_10076977 3300003203 Unclassified 1031
4 Ga0065704_10019214 3300005289 Bacteria 1642
5 Ga0065704_10070831 3300005289 Bacteria 15617
6 Ga0065704_10225337 3300005289 Bacteria 1060
7 Ga0065707_10004313 3300005295 Unclassified 4302
8 Ga0065707_10018217 3300005295 Bacteria 2129
9 Ga0065707_10082512 3300005295 Bacteria 14303
10 Ga0065707_10084694 3300005295 Bacteria 6878
11 Ga0065707_10087266 3300005295 Bacteria 5097
12 Ga0065707_10264446 3300005295 Bacteria 1039
13 Ga0070689_100244527 3300005340 Unclassified 1479
14 Ga0070689_101204179 3300005340 Unclassified 680
15 Ga0070669_100806089 3300005353 Bacteria 798
16 Ga0070705_100319901 3300005440 Unclassified 1119
17 Ga0070705_100655484 3300005440 Bacteria 819
18 Ga0070700_100428174 3300005441 Bacteria 1001
19 Ga0070694_100177624 3300005444 Bacteria 1573
20 Ga0070694_100408084 3300005444 Bacteria 1065
21 Ga0070706_100137698 3300005467 Bacteria 2278
22 Ga0070707_100011359 3300005468 Bacteria 8302
23 Ga0070707_100550598 3300005468 Bacteria 1116
24 Ga0070698_100023035 3300005471 Bacteria 6512
25 Ga0070698_100059375 3300005471 Unclassified 3863
26 Ga0070698_100113046 3300005471 Unclassified 2680
27 Ga0070698_100517489 3300005471 Bacteria 1131
28 Ga0070698_100517947 3300005471 Unclassified 1131
29 Ga0070698_100706256 3300005471 Bacteria 950
30 Ga0070699_100000590 3300005518 Bacteria 34183
31 Ga0070699_100005485 3300005518 Bacteria 11121
32 Ga0070699_100040814 3300005518 Bacteria 4017
33 Ga0070699_101157635 3300005518 Bacteria 709
34 Ga0070695_100531064 3300005545 Bacteria 914
35 Ga0070704_101085980 3300005549 Unclassified 726
36 Ga0068859_100021664 3300005617 Bacteria 6450
37 Ga0068864_100141706 3300005618 Bacteria 2169
38 Ga0068870_10178981 3300005840 Bacteria 1271
39 Ga0068860_101635672 3300005843 Bacteria 666
40 Ga0068862_100030350 3300005844 Bacteria 4555
41 Ga0068862_100033908 3300005844 Bacteria 4318
42 Ga0068862_100108232 3300005844 Unclassified 2438
43 Ga0068862_100160247 3300005844 Bacteria 2008
44 Ga0081539_10001257 3300005985 Bacteria 44920
45 Ga0081539_10051264 3300005985 Bacteria 2328
46 Ga0075427_10002415 3300006194 Bacteria 2502
47 Ga0075428_100056568 3300006844 Bacteria 4297
48 Ga0075428_100066744 3300006844 Bacteria 3939
49 Ga0075428_100292181 3300006844 Bacteria 1753
50 Ga0075428_101587658 3300006844 Bacteria 684
51 Ga0075428_101932649 3300006844 Bacteria 612
52 Ga0075430_101053120 3300006846 Unclassified 670
53 Ga0075430_101129984 3300006846 Bacteria 645
54 Ga0075430_101169978 3300006846 Unclassified 633
55 Ga0075431_100035370 3300006847 Bacteria 5143
56 Ga0075433_10031340 3300006852 Bacteria 4544
57 Ga0075433_10160270 3300006852 Bacteria 2002
58 Ga0075434_100078709 3300006871 Unclassified 3293
59 Ga0075429_100002969 3300006880 Bacteria 14385
60 Ga0075429_100061458 3300006880 Bacteria 3273
61 Ga0075429_100117807 3300006880 Bacteria 2321
62 Ga0075429_100440819 3300006880 Bacteria 1141
63 Ga0075429_100493154 3300006880 Unclassified 1073
64 Ga0075429_100517267 3300006880 Bacteria 1046
65 Ga0075429_100548981 3300006880 Bacteria 1013
66 Ga0075429_100690363 3300006880 Bacteria 894
67 Ga0097620_100021664 3300006931 Bacteria 6450
68 Ga0075435_100484642 3300007076 Bacteria 1068
69 Ga0105240_10412172 3300009093 Bacteria 1520
70 Ga0105245_10981247 3300009098 Bacteria 889
71 Ga0114129_10007047 3300009147 Bacteria 16003
72 Ga0114129_10091428 3300009147 Unclassified 4216
73 Ga0114129_10132629 3300009147 Bacteria 3420
74 Ga0114129_10200637 3300009147 Bacteria 2702
75 Ga0114129_10210813 3300009147 Unclassified 2626
76 Ga0114129_10512575 3300009147 Bacteria 1565
77 Ga0114129_12182548 3300009147 Bacteria 667
78 Ga0105243_10072705 3300009148 Bacteria 2784
79 Ga0105243_10546819 3300009148 Bacteria 1106
80 Ga0105237_11247952 3300009545 Bacteria 750
81 Ga0105249_10148911 3300009553 Unclassified 2251
82 Ga0105249_10156066 3300009553 Unclassified 2201
83 Ga0105249_10394767 3300009553 Bacteria 1412
84 Ga0105249_11149265 3300009553 Unclassified 847
85 Ga0207653_10052273 3300025885 Unclassified 1362
86 Ga0207684_10175141 3300025910 Bacteria 1850
87 Ga0207646_10016125 3300025922 Bacteria 7022
88 Ga0207646_10220584 3300025922 Bacteria 1713
89 Ga0207681_11109638 3300025923 Bacteria 664
90 Ga0207709_10387553 3300025935 Bacteria 1065
91 Ga0207712_10132666 3300025961 Bacteria 1900
92 Ga0207708_10386720 3300026075 Unclassified 1154
93 Ga0207675_100450828 3300026118 Bacteria 1275
94 Ga0268264_11455942 3300028381 Bacteria 695
95 Ga0265331_10229257 3300031250 Bacteria 834
96 Ga0307405_10544125 3300031731 Bacteria 938
97 Ga0307410_10182933 3300031852 Bacteria 1588
98 Ga0307406_10684681 3300031901 Bacteria 854
99 Ga0307407_10633208 3300031903 Bacteria 799
100 Ga0307415_100204376 3300032126 Bacteria 1570
101 Ga0373961_0043642 3300035241 Unclassified 1305
102 Ga0451577_0004964 3300042876 Bacteria 13821
103 Ga0451577_0009651 3300042876 Bacteria 9263
104 Ga0451577_0011960 3300042876 Bacteria 8177
105 Ga0451577_0023375 3300042876 Bacteria 5639
106 Ga0451577_0034901 3300042876 Unclassified 4532
107 Ga0451577_0425773 3300042876 Bacteria 1205
108 Ga0453683_0000296 3300044673 Bacteria 63665
109 Ga0453683_0029024 3300044673 Bacteria 3500
110 Ga0453683_0035740 3300044673 Bacteria 3130
111 Ga0453683_0069320 3300044673 Bacteria 2205
112 Ga0453683_0113034 3300044673 Unclassified 1708
113 Ga0453683_0132858 3300044673 Bacteria 1569
114 Ga0453683_0328121 3300044673 Bacteria 981
115 Ga0453683_0382397 3300044673 Unclassified 906
116 Ga0453684_0000808 3300044712 Bacteria 106678
117 Ga0453684_0002795 3300044712 Bacteria 41278
118 Ga0453684_0006123 3300044712 Bacteria 23170
119 Ga0453684_0009551 3300044712 Bacteria 16934
120 Ga0453684_0009943 3300044712 Bacteria 16413
121 Ga0453684_0020199 3300044712 Bacteria 10070
122 Ga0453684_0027590 3300044712 Bacteria 8136
123 Ga0453684_0030058 3300044712 Bacteria 7688
124 Ga0453684_0035034 3300044712 Bacteria 6949
125 Ga0453684_0059719 3300044712 Unclassified 4913
126 Ga0453684_0077756 3300044712 Bacteria 4156
127 Ga0453684_0082079 3300044712 Unclassified 4017
128 Ga0453684_0108901 3300044712 Bacteria 3371
129 Ga0453684_0117842 3300044712 Unclassified 3213
130 Ga0453684_0142105 3300044712 Bacteria 2864
131 Ga0453684_0153922 3300044712 Unclassified 2729
132 Ga0453684_0161547 3300044712 Bacteria 2649
133 Ga0453684_0228595 3300044712 Bacteria 2149
134 Ga0453684_0312909 3300044712 Bacteria 1781
135 Ga0453684_0320975 3300044712 Bacteria 1754
136 Ga0453684_0345660 3300044712 Viruses 1678
137 Ga0453684_0454191 3300044712 Bacteria 1426
138 Ga0453684_0470059 3300044712 Unclassified 1397
139 Ga0453684_0581234 3300044712 Unclassified 1230
140 Ga0453684_0647399 3300044712 Bacteria 1153
141 Ga0453684_0743376 3300044712 Bacteria 1062
142 Ga0453684_1723424 3300044712 Bacteria 639
143 Ga0451576_0000230 3300045051 Bacteria 136200
144 Ga0451576_0023712 3300045051 Bacteria 6639
145 Ga0451576_0034298 3300045051 Bacteria 5391
146 Ga0451576_0060482 3300045051 Bacteria 3952
147 Ga0451576_0258564 3300045051 Bacteria 1820
148 Ga0451576_0377665 3300045051 Unclassified 1485
149 Ga0451576_0472668 3300045051 Unclassified 1317
150 Ga0451576_0806494 3300045051 Bacteria 986
151 Ga0451576_1849312 3300045051 Unclassified 624
152 Ga0451576_1990068 3300045051 Bacteria 599
153 Ga0501040_0693560 3300049576 Unclassified 736
154 Ga0501072_0068783 3300049588 Unclassified 2795
155 Ga0501074_0505872 3300049590 Unclassified 856
156 Ga0501075_0024610 3300049591 Bacteria 4418
157 Ga0501076_0037336 3300049592 Bacteria 3809
158 Ga0501208_028341 3300049655 Unclassified 972
159 Ga0501227_082974 3300049665 Unclassified 841
160 Ga0501080_0084665 3300049742 Bacteria 2946
161 Ga0501045_0738265 3300049824 Unclassified 726
162 nmdc:mga05p37_188385_c1 3300050507 Unclassified 2507
163 nmdc:mga05p37_337297_c1 3300050507 Bacteria 1779
164 nmdc:mga05p37_348304_c1 3300050507 Bacteria 1745
165 nmdc:mga05p37_48894_c1 3300050507 Bacteria 5201
166 nmdc:mga05p37_6578_c1 3300050507 Bacteria 10663
167 nmdc:mga05p37_728571_c1 3300050507 Unclassified 1097
168 nmdc:mga09592_1060_c1 3300050508 Bacteria 21814
169 nmdc:mga09592_128395_c1 3300050508 Bacteria 2180
170 nmdc:mga09592_260753_c1 3300050508 Bacteria 1503
171 nmdc:mga09592_26392_c1 3300050508 Bacteria 4811
172 nmdc:mga09592_271429_c1 3300050508 Bacteria 1471
173 nmdc:mga09592_423769_c1 3300050508 Bacteria 1149
174 nmdc:mga09592_522280_c1 3300050508 Bacteria 1021
175 nmdc:mga0n895_342206_c1 3300050512 Bacteria 1515
176 nmdc:mga0rr50_576814_c1 3300050513 Bacteria 958
177 nmdc:mga0a205_222318_c1 3300050515 Bacteria 1773
178 nmdc:mga0a205_27648_c1 3300050515 Bacteria 1535
179 Ga0501084_0042191 3300054114 Bacteria 3816
180 Ga0530510_0100411 3300061734 Unclassified 2116

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0009551 Ga0453684_0009551_10905_11411 167
2 3300049824 Ga0501045_0738265 Ga0501045_0738265_22_537 169
3 3300044712 Ga0453684_0000808 Ga0453684_0000808_95775_96302 174
4 3300044712 Ga0453684_0020199 Ga0453684_0020199_8384_8911 174
5 3300044712 Ga0453684_0228595 Ga0453684_0228595_299_853 176
6 3300009093 Ga0105240_10412172 Ga0105240_104121721 178
7 3300009545 Ga0105237_11247952 Ga0105237_112479521 178
8 3300028381 Ga0268264_11455942 Ga0268264_114559421 179
9 3300005295 Ga0065707_10018217 Ga0065707_100182172 180
10 3300005295 Ga0065707_10264446 Ga0065707_102644461 180
11 3300005444 Ga0070694_100177624 Ga0070694_1001776242 180
12 3300005471 Ga0070698_100059375 Ga0070698_1000593752 180
13 3300006194 Ga0075427_10002415 Ga0075427_100024153 180
14 3300006844 Ga0075428_100056568 Ga0075428_1000565687 180
15 3300006844 Ga0075428_101932649 Ga0075428_1019326491 180
16 3300006847 Ga0075431_100035370 Ga0075431_1000353703 180
17 3300006880 Ga0075429_100117807 Ga0075429_1001178071 180
18 3300009147 Ga0114129_10512575 Ga0114129_105125753 180
19 3300009553 Ga0105249_11149265 Ga0105249_111492651 180
20 3300050507 nmdc:mga05p37_348304_c1 nmdc:mga05p37_348304_c1_264_806 180
21 3300050508 nmdc:mga09592_271429_c1 nmdc:mga09592_271429_c1_738_1280 180
22 3300003203 JGI25406J46586_10076977 JGI25406J46586_100769772 181
23 3300005289 Ga0065704_10019214 Ga0065704_100192142 181
24 3300005289 Ga0065704_10225337 Ga0065704_102253371 181
25 3300005295 Ga0065707_10084694 Ga0065707_100846945 181
26 3300005295 Ga0065707_10087266 Ga0065707_100872666 181
27 3300005340 Ga0070689_100244527 Ga0070689_1002445272 181
28 3300005340 Ga0070689_101204179 Ga0070689_1012041791 181
29 3300005353 Ga0070669_100806089 Ga0070669_1008060892 181
30 3300005440 Ga0070705_100319901 Ga0070705_1003199011 181
31 3300005440 Ga0070705_100655484 Ga0070705_1006554841 181
32 3300005441 Ga0070700_100428174 Ga0070700_1004281742 181
33 3300005444 Ga0070694_100408084 Ga0070694_1004080841 181
34 3300005471 Ga0070698_100113046 Ga0070698_1001130463 181
35 3300005471 Ga0070698_100517489 Ga0070698_1005174891 181
36 3300005471 Ga0070698_100517947 Ga0070698_1005179472 181
37 3300005471 Ga0070698_100706256 Ga0070698_1007062562 181
38 3300005549 Ga0070704_101085980 Ga0070704_1010859801 181
39 3300005617 Ga0068859_100021664 Ga0068859_1000216645 181
40 3300005843 Ga0068860_101635672 Ga0068860_1016356721 181
41 3300005844 Ga0068862_100030350 Ga0068862_1000303505 181
42 3300005844 Ga0068862_100033908 Ga0068862_1000339083 181
43 3300005844 Ga0068862_100108232 Ga0068862_1001082323 181
44 3300005985 Ga0081539_10001257 Ga0081539_1000125718 181
45 3300005985 Ga0081539_10051264 Ga0081539_100512642 181
46 3300006844 Ga0075428_100066744 Ga0075428_1000667443 181
47 3300006846 Ga0075430_101053120 Ga0075430_1010531201 181
48 3300006852 Ga0075433_10031340 Ga0075433_100313403 181
49 3300006871 Ga0075434_100078709 Ga0075434_1000787092 181
50 3300006880 Ga0075429_100440819 Ga0075429_1004408192 181
51 3300006880 Ga0075429_100517267 Ga0075429_1005172672 181
52 3300006880 Ga0075429_100690363 Ga0075429_1006903631 181
53 3300006931 Ga0097620_100021664 Ga0097620_1000216642 181
54 3300007076 Ga0075435_100484642 Ga0075435_1004846422 181
55 3300009098 Ga0105245_10981247 Ga0105245_109812471 181
56 3300009147 Ga0114129_10091428 Ga0114129_100914284 181
57 3300009147 Ga0114129_10200637 Ga0114129_102006373 181
58 3300009148 Ga0105243_10072705 Ga0105243_100727054 181
59 3300009553 Ga0105249_10148911 Ga0105249_101489112 181
60 3300009553 Ga0105249_10156066 Ga0105249_101560661 181
61 3300025885 Ga0207653_10052273 Ga0207653_100522732 181
62 3300025923 Ga0207681_11109638 Ga0207681_111096381 181
63 3300025935 Ga0207709_10387553 Ga0207709_103875532 181
64 3300025961 Ga0207712_10132666 Ga0207712_101326662 181
65 3300026075 Ga0207708_10386720 Ga0207708_103867201 181
66 3300026118 Ga0207675_100450828 Ga0207675_1004508281 181
67 3300031250 Ga0265331_10229257 Ga0265331_102292571 181
68 3300042876 Ga0451577_0004964 Ga0451577_0004964_1007_1552 181
69 3300042876 Ga0451577_0009651 Ga0451577_0009651_6208_6753 181
70 3300042876 Ga0451577_0011960 Ga0451577_0011960_2486_3031 181
71 3300042876 Ga0451577_0034901 Ga0451577_0034901_3334_3879 181
72 3300042876 Ga0451577_0425773 Ga0451577_0425773_515_1072 181
73 3300044673 Ga0453683_0000296 Ga0453683_0000296_43313_43861 181
74 3300044673 Ga0453683_0035740 Ga0453683_0035740_302_847 181
75 3300044673 Ga0453683_0113034 Ga0453683_0113034_330_875 181
76 3300044673 Ga0453683_0382397 Ga0453683_0382397_25_576 181
77 3300044712 Ga0453684_0006123 Ga0453684_0006123_15823_16368 181
78 3300044712 Ga0453684_0009551 Ga0453684_0009551_11488_12033 181
79 3300044712 Ga0453684_0009943 Ga0453684_0009943_10937_11482 181
80 3300044712 Ga0453684_0027590 Ga0453684_0027590_1773_2330 181
81 3300044712 Ga0453684_0030058 Ga0453684_0030058_2501_3046 181
82 3300044712 Ga0453684_0035034 Ga0453684_0035034_3833_4378 181
83 3300044712 Ga0453684_0059719 Ga0453684_0059719_408_953 181
84 3300044712 Ga0453684_0077756 Ga0453684_0077756_3195_3740 181
85 3300044712 Ga0453684_0108901 Ga0453684_0108901_2578_3123 181
86 3300044712 Ga0453684_0142105 Ga0453684_0142105_265_810 181
87 3300044712 Ga0453684_0153922 Ga0453684_0153922_858_1403 181
88 3300044712 Ga0453684_0161547 Ga0453684_0161547_1117_1662 181
89 3300044712 Ga0453684_0320975 Ga0453684_0320975_554_1099 181
90 3300044712 Ga0453684_0345660 Ga0453684_0345660_1105_1650 181
91 3300044712 Ga0453684_0470059 Ga0453684_0470059_356_901 181
92 3300044712 Ga0453684_0581234 Ga0453684_0581234_675_1220 181
93 3300044712 Ga0453684_0647399 Ga0453684_0647399_534_1079 181
94 3300044712 Ga0453684_0743376 Ga0453684_0743376_322_867 181
95 3300044712 Ga0453684_1723424 Ga0453684_1723424_77_622 181
96 3300045051 Ga0451576_0000230 Ga0451576_0000230_94807_95352 181
97 3300045051 Ga0451576_0023712 Ga0451576_0023712_3491_4039 181
98 3300045051 Ga0451576_0034298 Ga0451576_0034298_2513_3058 181
99 3300045051 Ga0451576_0060482 Ga0451576_0060482_57_602 181
100 3300045051 Ga0451576_0806494 Ga0451576_0806494_13_615 181
101 3300045051 Ga0451576_1849312 Ga0451576_1849312_56_601 181
102 3300049576 Ga0501040_0693560 Ga0501040_0693560_53_604 181
103 3300049588 Ga0501072_0068783 Ga0501072_0068783_1774_2325 181
104 3300049590 Ga0501074_0505872 Ga0501074_0505872_97_648 181
105 3300049591 Ga0501075_0024610 Ga0501075_0024610_1014_1565 181
106 3300049592 Ga0501076_0037336 Ga0501076_0037336_1365_1916 181
107 3300049742 Ga0501080_0084665 Ga0501080_0084665_1952_2503 181
108 3300050507 nmdc:mga05p37_188385_c1 nmdc:mga05p37_188385_c1_346_891 181
109 3300050507 nmdc:mga05p37_48894_c1 nmdc:mga05p37_48894_c1_2210_2755 181
110 3300050508 nmdc:mga09592_260753_c1 nmdc:mga09592_260753_c1_166_711 181
111 3300050512 nmdc:mga0n895_342206_c1 nmdc:mga0n895_342206_c1_794_1339 181
112 3300050513 nmdc:mga0rr50_576814_c1 nmdc:mga0rr50_576814_c1_207_752 181
113 3300050515 nmdc:mga0a205_27648_c1 nmdc:mga0a205_27648_c1_437_982 181
114 3300054114 Ga0501084_0042191 Ga0501084_0042191_3018_3569 181
115 3300061734 Ga0530510_0100411 Ga0530510_0100411_190_741 181
116 2162886006 SwRhRL3b_contig_133186 SwRhRL3b_0174.00002180 182
117 2162886007 SwRhRL2b_contig_2432529 SwRhRL2b_0201.00003130 182
118 3300005289 Ga0065704_10070831 Ga0065704_1007083110 182
119 3300005295 Ga0065707_10004313 Ga0065707_100043134 182
120 3300005295 Ga0065707_10082512 Ga0065707_100825128 182
121 3300005467 Ga0070706_100137698 Ga0070706_1001376983 182
122 3300005468 Ga0070707_100011359 Ga0070707_1000113592 182
123 3300005468 Ga0070707_100550598 Ga0070707_1005505982 182
124 3300005471 Ga0070698_100023035 Ga0070698_1000230353 182
125 3300005518 Ga0070699_100000590 Ga0070699_10000059010 182
126 3300005518 Ga0070699_100005485 Ga0070699_10000548513 182
127 3300005518 Ga0070699_100040814 Ga0070699_1000408145 182
128 3300005518 Ga0070699_101157635 Ga0070699_1011576351 182
129 3300005545 Ga0070695_100531064 Ga0070695_1005310641 182
130 3300005618 Ga0068864_100141706 Ga0068864_1001417064 182
131 3300005840 Ga0068870_10178981 Ga0068870_101789813 182
132 3300005844 Ga0068862_100160247 Ga0068862_1001602472 182
133 3300006844 Ga0075428_100292181 Ga0075428_1002921813 182
134 3300006844 Ga0075428_101587658 Ga0075428_1015876581 182
135 3300006846 Ga0075430_101129984 Ga0075430_1011299841 182
136 3300006846 Ga0075430_101169978 Ga0075430_1011699781 182
137 3300006852 Ga0075433_10160270 Ga0075433_101602702 182
138 3300006880 Ga0075429_100002969 Ga0075429_10000296910 182
139 3300006880 Ga0075429_100061458 Ga0075429_1000614584 182
140 3300006880 Ga0075429_100493154 Ga0075429_1004931542 182
141 3300006880 Ga0075429_100548981 Ga0075429_1005489812 182
142 3300009147 Ga0114129_10007047 Ga0114129_1000704712 182
143 3300009147 Ga0114129_10132629 Ga0114129_101326292 182
144 3300009147 Ga0114129_10210813 Ga0114129_102108132 182
145 3300009147 Ga0114129_12182548 Ga0114129_121825481 182
146 3300009148 Ga0105243_10546819 Ga0105243_105468192 182
147 3300009553 Ga0105249_10394767 Ga0105249_103947672 182
148 3300025910 Ga0207684_10175141 Ga0207684_101751412 182
149 3300025922 Ga0207646_10016125 Ga0207646_100161257 182
150 3300025922 Ga0207646_10220584 Ga0207646_102205843 182
151 3300031731 Ga0307405_10544125 Ga0307405_105441252 182
152 3300031852 Ga0307410_10182933 Ga0307410_101829332 182
153 3300031901 Ga0307406_10684681 Ga0307406_106846812 182
154 3300031903 Ga0307407_10633208 Ga0307407_106332082 182
155 3300032126 Ga0307415_100204376 Ga0307415_1002043762 182
156 3300035241 Ga0373961_0043642 Ga0373961_0043642_495_1043 182
157 3300042876 Ga0451577_0023375 Ga0451577_0023375_3273_3839 182
158 3300044673 Ga0453683_0029024 Ga0453683_0029024_2280_2828 182
159 3300044673 Ga0453683_0069320 Ga0453683_0069320_244_807 182
160 3300044673 Ga0453683_0132858 Ga0453683_0132858_306_857 182
161 3300044673 Ga0453683_0328121 Ga0453683_0328121_334_882 182
162 3300044712 Ga0453684_0002795 Ga0453684_0002795_21487_22041 182
163 3300044712 Ga0453684_0082079 Ga0453684_0082079_1978_2529 182
164 3300044712 Ga0453684_0117842 Ga0453684_0117842_351_899 182
165 3300044712 Ga0453684_0312909 Ga0453684_0312909_1176_1724 182
166 3300044712 Ga0453684_0454191 Ga0453684_0454191_378_929 182
167 3300045051 Ga0451576_0258564 Ga0451576_0258564_183_746 182
168 3300045051 Ga0451576_0377665 Ga0451576_0377665_716_1282 182
169 3300045051 Ga0451576_0472668 Ga0451576_0472668_421_969 182
170 3300045051 Ga0451576_1990068 Ga0451576_1990068_36_587 182
171 3300049655 Ga0501208_028341 Ga0501208_028341_55_624 182
172 3300049665 Ga0501227_082974 Ga0501227_082974_190_759 182
173 3300050507 nmdc:mga05p37_337297_c1 nmdc:mga05p37_337297_c1_1060_1608 182
174 3300050507 nmdc:mga05p37_6578_c1 nmdc:mga05p37_6578_c1_2612_3160 182
175 3300050507 nmdc:mga05p37_728571_c1 nmdc:mga05p37_728571_c1_429_977 182
176 3300050508 nmdc:mga09592_1060_c1 nmdc:mga09592_1060_c1_16723_17271 182
177 3300050508 nmdc:mga09592_128395_c1 nmdc:mga09592_128395_c1_689_1240 182
178 3300050508 nmdc:mga09592_26392_c1 nmdc:mga09592_26392_c1_1437_1985 182
179 3300050508 nmdc:mga09592_423769_c1 nmdc:mga09592_423769_c1_403_966 182
180 3300050508 nmdc:mga09592_522280_c1 nmdc:mga09592_522280_c1_241_804 182
181 3300050515 nmdc:mga0a205_222318_c1 nmdc:mga0a205_222318_c1_1165_1713 182

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03352

Adenine_glyco

Methyladenine glycosylase

9

120

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ai5-assembly3.cif.gz_C crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine 0.8964 8 167
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.893 16 158
4aia-assembly4.cif.gz_D the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus 0.8839 8 167
4ai4-assembly1.cif.gz_A crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus 0.8791 8 167
1p7m-assembly1.cif.gz_A solution structure and base perturbation studies reveal a novel mode of alkylated base recognition by 3-methyladenine dna glycosylase i 0.8567 11 165
ID Description Score Start End Superfamily
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9029 16 165 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8917 16 156 1.10.340.30
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8912 8 167 1.10.340.30
af_O05311_6_193_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8749 12 167 1.10.340.30
1p7mA00 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8567 11 165 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A533SQH5-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9989 1 122 GO:0006284
GO:0008725
GO:0046872
AF-A0A5Q4G7I6-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9914 16 182 GO:0006284
GO:0008725
GO:0046872
AF-A0A7Y5K9N5-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9891 1 181 GO:0006284
GO:0008725
GO:0046872
AF-A0A7Y5K9N5-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9837 1 181 GO:0006284
GO:0008725
GO:0046872
AF-A0A3C2C8F6-F1-model_v4 deleted 0.9826 18 178

Feature Viewer

pLDDT pTM Quality
93.73 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map