F277855

General Info

Members Datasets Scaffolds Average Seq Length
181 87 362 217

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0005862|Ga0453684_0005862_21418_22194
Length 258
Sequence VPAIPTFIIHPAFEANIDHLETGDIFFRSNLSTNFVYKTERITRYMEDSFQHKGLRKKLVEEIRLKGIKDERVLNAIGKVPRHLFMDSGFIKFAYRDQAFPIDAGQSISQPFTVAFQSELLQTEQGQKILEVGTGSGYQAAVLAELGVKVFTIERHRELYLKSQMLLNSLNYRVNFFYGDGYQGLPTYGPFDRILITAAAPDIPSVLLDQMKVGGRLVVPVGTGNSQVMTLIEKTGDSEYRKTEHGSFVFVPMLGGKQ

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
24 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
28 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
29 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
30 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
46 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
51 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
52 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
55 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
56 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
57 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
58 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
59 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
60 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
61 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
62 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
68 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
71 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
72 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
73 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
74 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
75 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
76 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
77 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
78 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
79 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
80 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
81 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
82 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
83 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
84 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
85 2914759650 Rhizosphaericola mali Isolate Rhizosphere
86 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
87 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 0
Isolates 2.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.66
Nodule 0
Rhizoplane 0
Rhizosphere 96.13
Stem 0
Stem Tuber 0
Unclassified 11.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0005862 3300044712 Bacteria 23879
2 MBSR1b_contig_741780 2162886012 Unclassified 2354
3 MBSR1b_contig_958826 2162886012 Unclassified 2348
4 rootH1_10105977 3300003323 Bacteria 7399
5 Ga0065704_10121616 3300005289 Bacteria 1763
6 Ga0065707_10028976 3300005295 Unclassified 1361
7 Ga0070689_100024949 3300005340 Bacteria 4488
8 Ga0070668_100041057 3300005347 Bacteria 3543
9 Ga0070669_100016468 3300005353 Bacteria 5274
10 Ga0070675_100407727 3300005354 Unclassified 1213
11 Ga0070673_100047734 3300005364 Bacteria 3333
12 Ga0070688_100000902 3300005365 Bacteria 14816
13 Ga0070713_100104414 3300005436 Bacteria 2460
14 Ga0068867_100030816 3300005459 Bacteria 3869
15 Ga0068867_100198986 3300005459 Bacteria 1603
16 Ga0070685_10039168 3300005466 Bacteria 2691
17 Ga0070672_100144036 3300005543 Unclassified 1968
18 Ga0070672_100308363 3300005543 Unclassified 1343
19 Ga0068857_100034931 3300005577 Bacteria 4449
20 Ga0068861_100021013 3300005719 Bacteria 4687
21 Ga0070716_100045737 3300006173 Bacteria 2459
22 Ga0075428_100346036 3300006844 Bacteria 1596
23 Ga0105240_10000037 3300009093 Bacteria 270462
24 Ga0111539_10015908 3300009094 Bacteria 9343
25 Ga0105239_10205143 3300010375 Bacteria 2209
26 Ga0105239_11651651 3300010375 Bacteria 741
27 Ga0157370_10002283 3300013104 Bacteria 23248
28 Ga0157370_10145393 3300013104 Bacteria 2208
29 Ga0163162_10065059 3300013306 Bacteria 3692
30 Ga0163162_10791604 3300013306 Bacteria 1066
31 Ga0157372_10239959 3300013307 Bacteria 2103
32 Ga0157375_10278006 3300013308 Bacteria 1837
33 Ga0157380_10000112 3300014326 Bacteria 44434
34 Ga0157380_10038451 3300014326 Bacteria 3715
35 Ga0157377_10002834 3300014745 Bacteria 7741
36 Ga0163161_10010995 3300017792 Bacteria 6272
37 Ga0163161_10381268 3300017792 Bacteria 1127
38 Ga0207697_10035421 3300025315 Bacteria 2043
39 Ga0207643_10005014 3300025908 Bacteria 7093
40 Ga0207681_10050686 3300025923 Bacteria 2809
41 Ga0207650_10021532 3300025925 Bacteria 4555
42 Ga0207700_10322078 3300025928 Bacteria 1340
43 Ga0207664_10173302 3300025929 Bacteria 1848
44 Ga0207706_10021449 3300025933 Bacteria 5801
45 Ga0207670_10049481 3300025936 Bacteria 2812
46 Ga0207691_10420954 3300025940 Unclassified 1138
47 Ga0207691_10881207 3300025940 Bacteria 750
48 Ga0207689_10083440 3300025942 Bacteria 2627
49 Ga0207651_10669820 3300025960 Unclassified 912
50 Ga0207668_10401607 3300025972 Unclassified 1159
51 Ga0207648_10036884 3300026089 Bacteria 4306
52 Ga0207648_10144865 3300026089 Bacteria 2095
53 Ga0207674_10006163 3300026116 Bacteria 14164
54 Ga0207675_100001073 3300026118 Bacteria 27154
55 Ga0207428_10097161 3300027907 Bacteria 2280
56 Ga0265323_10000021 3300028653 Bacteria 87631
57 Ga0265323_10037158 3300028653 Bacteria 1786
58 Ga0265338_10001166 3300028800 Bacteria 43408
59 Ga0265330_10109617 3300031235 Unclassified 1180
60 Ga0265327_10000026 3300031251 Bacteria 379288
61 Ga0265327_10003714 3300031251 Bacteria 14221
62 Ga0265316_10000989 3300031344 Bacteria 30846
63 Ga0265316_10001858 3300031344 Bacteria 22219
64 Ga0265316_10002580 3300031344 Bacteria 18719
65 Ga0265316_10195474 3300031344 Unclassified 1501
66 Ga0316579_10236008 3300031691 Bacteria 885
67 Ga0265342_10066396 3300031712 Unclassified 2113
68 Ga0316576_10005479 3300031727 Bacteria 7764
69 Ga0316576_10006829 3300031727 Bacteria 7132
70 Ga0316576_10027849 3300031727 Bacteria 3975
71 Ga0316576_10073034 3300031727 Unclassified 2534
72 Ga0316576_10124460 3300031727 Bacteria 1937
73 Ga0316578_10049221 3300031728 Bacteria 2462
74 Ga0316578_10074843 3300031728 Bacteria 2008
75 Ga0316577_10091253 3300031733 Bacteria 1705
76 Ga0307414_10017845 3300032004 Bacteria 4353
77 Ga0307411_10013268 3300032005 Bacteria 4539
78 Ga0316585_10003141 3300032137 Bacteria 4509
79 Ga0316580_10007624 3300032139 Bacteria 3226
80 Ga0316580_10028805 3300032139 Bacteria 1717
81 Ga0316580_10065983 3300032139 Bacteria 1110
82 Ga0316574_0029514 3300035398 Unclassified 3314
83 Ga0316582_0139659 3300036647 Bacteria 1633
84 Ga0316584_0071940 3300036712 Bacteria 2591
85 Ga0316584_0258610 3300036712 Bacteria 1270
86 Ga0395905_0001869 3300037471 Bacteria 24246
87 Ga0395901_0035333 3300038443 Bacteria 5162
88 Ga0400483_102256 3300039062 Bacteria 3105
89 Ga0400483_276446 3300039062 Bacteria 1305
90 Ga0451577_0000048 3300042876 Bacteria 309377
91 Ga0451577_0000317 3300042876 Bacteria 91191
92 Ga0451577_0006262 3300042876 Bacteria 11923
93 Ga0451577_0024395 3300042876 Bacteria 5502
94 Ga0451577_0050655 3300042876 Bacteria 3707
95 Ga0451577_0076389 3300042876 Bacteria 2986
96 Ga0451577_0088486 3300042876 Unclassified 2763
97 Ga0451577_0096195 3300042876 Bacteria 2644
98 Ga0451577_0108208 3300042876 Unclassified 2485
99 Ga0451577_0230982 3300042876 Bacteria 1673
100 Ga0451577_0267956 3300042876 Bacteria 1547
101 Ga0451577_0290852 3300042876 Bacteria 1480
102 Ga0451577_0439331 3300042876 Bacteria 1185
103 Ga0453683_0000010 3300044673 Bacteria 470890
104 Ga0453683_0000078 3300044673 Bacteria 147056
105 Ga0453683_0000105 3300044673 Bacteria 124993
106 Ga0453683_0000504 3300044673 Bacteria 44527
107 Ga0453683_0009591 3300044673 Bacteria 6457
108 Ga0453683_0010525 3300044673 Bacteria 6125
109 Ga0453683_0026387 3300044673 Bacteria 3689
110 Ga0453683_0028710 3300044673 Bacteria 3521
111 Ga0453683_0071242 3300044673 Bacteria 2174
112 Ga0453683_0123474 3300044673 Bacteria 1630
113 Ga0453683_0127062 3300044673 Bacteria 1605
114 Ga0453683_0128852 3300044673 Unclassified 1594
115 Ga0453683_0314680 3300044673 Bacteria 1002
116 Ga0453683_0592890 3300044673 Bacteria 722
117 Ga0453684_0000161 3300044712 Bacteria 298175
118 Ga0453684_0000202 3300044712 Bacteria 261894
119 Ga0453684_0000919 3300044712 Bacteria 97826
120 Ga0453684_0001032 3300044712 Bacteria 89042
121 Ga0453684_0002389 3300044712 Bacteria 45768
122 Ga0453684_0006196 3300044712 Bacteria 22943
123 Ga0453684_0008816 3300044712 Bacteria 17887
124 Ga0453684_0019592 3300044712 Bacteria 10284
125 Ga0453684_0028073 3300044712 Bacteria 8044
126 Ga0453684_0030080 3300044712 Bacteria 7685
127 Ga0453684_0037383 3300044712 Bacteria 6665
128 Ga0453684_0045482 3300044712 Bacteria 5855
129 Ga0453684_0048308 3300044712 Bacteria 5630
130 Ga0453684_0050292 3300044712 Bacteria 5485
131 Ga0453684_0122856 3300044712 Bacteria 3131
132 Ga0453684_0129827 3300044712 Bacteria 3025
133 Ga0453684_0166159 3300044712 Bacteria 2605
134 Ga0453684_0199436 3300044712 Bacteria 2334
135 Ga0453684_0289725 3300044712 Bacteria 1865
136 Ga0453684_0328736 3300044712 Bacteria 1729
137 Ga0453684_0386447 3300044712 Bacteria 1570
138 Ga0453684_0452068 3300044712 Bacteria 1430
139 Ga0453684_0523148 3300044712 Bacteria 1310
140 Ga0453684_0599134 3300044712 Bacteria 1208
141 Ga0453684_0953573 3300044712 Unclassified 915
142 Ga0453684_0997919 3300044712 Unclassified 891
143 Ga0466970_0029066 3300044765 Bacteria 2908
144 Ga0451576_0000059 3300045051 Bacteria 296795
145 Ga0451576_0000232 3300045051 Bacteria 135846
146 Ga0451576_0000389 3300045051 Bacteria 102554
147 Ga0451576_0000830 3300045051 Bacteria 60243
148 Ga0451576_0001257 3300045051 Bacteria 44542
149 Ga0451576_0002323 3300045051 Bacteria 28799
150 Ga0451576_0004943 3300045051 Bacteria 16969
151 Ga0451576_0006466 3300045051 Bacteria 14362
152 Ga0451576_0030262 3300045051 Bacteria 5788
153 Ga0451576_0076600 3300045051 Bacteria 3480
154 Ga0451576_0116720 3300045051 Bacteria 2778
155 Ga0451576_0147684 3300045051 Bacteria 2451
156 Ga0451576_0224891 3300045051 Bacteria 1960
157 Ga0451576_0325413 3300045051 Unclassified 1609
158 Ga0451576_0505862 3300045051 Bacteria 1269
159 Ga0451576_0599741 3300045051 Bacteria 1157
160 Ga0451576_0801043 3300045051 Bacteria 989
161 Ga0451576_1052030 3300045051 Bacteria 852
162 Ga0451576_1432863 3300045051 Bacteria 718
163 Ga0495607_0145711 3300046501 Bacteria 1217
164 Ga0495606_0058003 3300046507 Bacteria 2491
165 Ga0495616_0052150 3300046513 Bacteria 2037
166 Ga0495643_0000506 3300046522 Bacteria 48801
167 Ga0495668_0000078 3300046616 Bacteria 157809
168 Ga0495670_0270841 3300046691 Bacteria 907
169 Ga0495686_0000719 3300047472 Bacteria 44326
170 Ga0496122_0194536 3300048925 Bacteria 1193
171 Ga0501269_002503 3300049766 Unclassified 2259
172 Ga0501269_013864 3300049766 Bacteria 988
173 Ga0501044_0897509 3300049823 Bacteria 761
174 nmdc:mga08y16_102873_c1 3300050511 Bacteria 2974
175 Ga0500641_0000083 3300053096 Bacteria 37649
176 Ga0500616_0002715 3300053153 Bacteria 14361
177 Ga0500627_0021383 3300053158 Bacteria 2610
178 2881957016 2881955468 Bacteria 3545609
179 2914761772 2914759650 Bacteria 4701441
180 2965323457 2965320100 Bacteria 3975600
181 8036738092 8036736890 Bacteria 2944828
182 Ga0453684_0005862
183 MBSR1b_contig_741780
184 MBSR1b_contig_958826
185 rootH1_10105977
186 Ga0065704_10121616
187 Ga0065707_10028976
188 Ga0070689_100024949
189 Ga0070668_100041057
190 Ga0070669_100016468
191 Ga0070675_100407727
192 Ga0070673_100047734
193 Ga0070688_100000902
194 Ga0070713_100104414
195 Ga0068867_100030816
196 Ga0068867_100198986
197 Ga0070685_10039168
198 Ga0070672_100144036
199 Ga0070672_100308363
200 Ga0068857_100034931
201 Ga0068861_100021013
202 Ga0070716_100045737
203 Ga0075428_100346036
204 Ga0105240_10000037
205 Ga0111539_10015908
206 Ga0105239_10205143
207 Ga0105239_11651651
208 Ga0157370_10002283
209 Ga0157370_10145393
210 Ga0163162_10065059
211 Ga0163162_10791604
212 Ga0157372_10239959
213 Ga0157375_10278006
214 Ga0157380_10000112
215 Ga0157380_10038451
216 Ga0157377_10002834
217 Ga0163161_10010995
218 Ga0163161_10381268
219 Ga0207697_10035421
220 Ga0207643_10005014
221 Ga0207681_10050686
222 Ga0207650_10021532
223 Ga0207700_10322078
224 Ga0207664_10173302
225 Ga0207706_10021449
226 Ga0207670_10049481
227 Ga0207691_10420954
228 Ga0207691_10881207
229 Ga0207689_10083440
230 Ga0207651_10669820
231 Ga0207668_10401607
232 Ga0207648_10036884
233 Ga0207648_10144865
234 Ga0207674_10006163
235 Ga0207675_100001073
236 Ga0207428_10097161
237 Ga0265323_10000021
238 Ga0265323_10037158
239 Ga0265338_10001166
240 Ga0265330_10109617
241 Ga0265327_10000026
242 Ga0265327_10003714
243 Ga0265316_10000989
244 Ga0265316_10001858
245 Ga0265316_10002580
246 Ga0265316_10195474
247 Ga0316579_10236008
248 Ga0265342_10066396
249 Ga0316576_10005479
250 Ga0316576_10006829
251 Ga0316576_10027849
252 Ga0316576_10073034
253 Ga0316576_10124460
254 Ga0316578_10049221
255 Ga0316578_10074843
256 Ga0316577_10091253
257 Ga0307414_10017845
258 Ga0307411_10013268
259 Ga0316585_10003141
260 Ga0316580_10007624
261 Ga0316580_10028805
262 Ga0316580_10065983
263 Ga0316574_0029514
264 Ga0316582_0139659
265 Ga0316584_0071940
266 Ga0316584_0258610
267 Ga0395905_0001869
268 Ga0395901_0035333
269 Ga0400483_102256
270 Ga0400483_276446
271 Ga0451577_0000048
272 Ga0451577_0000317
273 Ga0451577_0006262
274 Ga0451577_0024395
275 Ga0451577_0050655
276 Ga0451577_0076389
277 Ga0451577_0088486
278 Ga0451577_0096195
279 Ga0451577_0108208
280 Ga0451577_0230982
281 Ga0451577_0267956
282 Ga0451577_0290852
283 Ga0451577_0439331
284 Ga0453683_0000010
285 Ga0453683_0000078
286 Ga0453683_0000105
287 Ga0453683_0000504
288 Ga0453683_0009591
289 Ga0453683_0010525
290 Ga0453683_0026387
291 Ga0453683_0028710
292 Ga0453683_0071242
293 Ga0453683_0123474
294 Ga0453683_0127062
295 Ga0453683_0128852
296 Ga0453683_0314680
297 Ga0453683_0592890
298 Ga0453684_0000161
299 Ga0453684_0000202
300 Ga0453684_0000919
301 Ga0453684_0001032
302 Ga0453684_0002389
303 Ga0453684_0006196
304 Ga0453684_0008816
305 Ga0453684_0019592
306 Ga0453684_0028073
307 Ga0453684_0030080
308 Ga0453684_0037383
309 Ga0453684_0045482
310 Ga0453684_0048308
311 Ga0453684_0050292
312 Ga0453684_0122856
313 Ga0453684_0129827
314 Ga0453684_0166159
315 Ga0453684_0199436
316 Ga0453684_0289725
317 Ga0453684_0328736
318 Ga0453684_0386447
319 Ga0453684_0452068
320 Ga0453684_0523148
321 Ga0453684_0599134
322 Ga0453684_0953573
323 Ga0453684_0997919
324 Ga0466970_0029066
325 Ga0451576_0000059
326 Ga0451576_0000232
327 Ga0451576_0000389
328 Ga0451576_0000830
329 Ga0451576_0001257
330 Ga0451576_0002323
331 Ga0451576_0004943
332 Ga0451576_0006466
333 Ga0451576_0030262
334 Ga0451576_0076600
335 Ga0451576_0116720
336 Ga0451576_0147684
337 Ga0451576_0224891
338 Ga0451576_0325413
339 Ga0451576_0505862
340 Ga0451576_0599741
341 Ga0451576_0801043
342 Ga0451576_1052030
343 Ga0451576_1432863
344 Ga0495607_0145711
345 Ga0495606_0058003
346 Ga0495616_0052150
347 Ga0495643_0000506
348 Ga0495668_0000078
349 Ga0495670_0270841
350 Ga0495686_0000719
351 Ga0496122_0194536
352 Ga0501269_002503
353 Ga0501269_013864
354 Ga0501044_0897509
355 nmdc:mga08y16_102873_c1
356 Ga0500641_0000083
357 Ga0500616_0002715
358 Ga0500627_0021383
359 2881957016
360 2914761772
361 2965323457
362 8036738092

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

54

258

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4o29-assembly1.cif.gz_A protein-l-isoaspartate o-methyltransferase from pyrobaculum aerophilum in complex with s-adenosyl-l-homocysteine 0.948 7 201
1jg3-assembly1.cif.gz_A crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with adenosine & vyp(isp)ha substrate 0.9464 7 202
3lbf-assembly4.cif.gz_D crystal structure of protein l-isoaspartyl methyltransferase from escherichia coli 0.9431 7 206
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.9387 6 204
4l7v-assembly1.cif.gz_A crystal structure of protein l-isoaspartyl-o-methyltransferase of vibrio cholerae 0.9376 7 206
ID Description Score Start End Superfamily
4o29A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.948 7 201 3.40.50.150
1jg3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9464 7 202 3.40.50.150
4l7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9376 7 206 3.40.50.150
1jg3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8976 7 202 3.40.50.150
4o29A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8946 7 201 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A4Q5U112-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) (PIMT) 0.9822 7 206 GO:0004719
GO:0005737
GO:0030091
GO:0032259
GO:0036211
AF-A0A2T7BEA5-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) (PIMT) 0.9802 7 206 GO:0004719
GO:0005737
GO:0030091
GO:0032259
GO:0036211
AF-A0A6B9ZNS3-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) (PIMT) 0.9799 7 205 GO:0004719
GO:0005737
GO:0030091
GO:0032259
GO:0036211
AF-A0A352CK14-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) 0.9794 7 165 GO:0004719
GO:0005737
GO:0032259
GO:0036211
AF-A0A2W7RXQ9-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) (PIMT) 0.9777 7 206 GO:0004719
GO:0005737
GO:0030091
GO:0032259
GO:0036211

Map