F277855
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 181 | 87 | 362 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0005862|Ga0453684_0005862_21418_22194 |
| Length | 258 |
| Sequence | VPAIPTFIIHPAFEANIDHLETGDIFFRSNLSTNFVYKTERITRYMEDSFQHKGLRKKLVEEIRLKGIKDERVLNAIGKVPRHLFMDSGFIKFAYRDQAFPIDAGQSISQPFTVAFQSELLQTEQGQKILEVGTGSGYQAAVLAELGVKVFTIERHRELYLKSQMLLNSLNYRVNFFYGDGYQGLPTYGPFDRILITAAAPDIPSVLLDQMKVGGRLVVPVGTGNSQVMTLIEKTGDSEYRKTEHGSFVFVPMLGGKQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 14 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 17 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 18 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 20 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 21 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 24 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 27 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 46 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 47 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 48 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 49 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 50 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 51 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 52 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 53 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 54 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 55 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 56 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 57 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 58 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 59 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 60 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 61 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 62 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 63 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 64 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 65 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 66 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 67 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 68 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 69 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 70 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 78 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 79 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 80 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 81 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 82 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 83 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 84 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 85 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 86 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 87 | 8036736890 | Flavobacterium dauae TCH3-2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.79 |
| Metatranscriptomes | 0 |
| Isolates | 2.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.66 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 96.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0453684_0005862 | 3300044712 | Bacteria | 23879 |
| 2 | MBSR1b_contig_741780 | 2162886012 | Unclassified | 2354 |
| 3 | MBSR1b_contig_958826 | 2162886012 | Unclassified | 2348 |
| 4 | rootH1_10105977 | 3300003323 | Bacteria | 7399 |
| 5 | Ga0065704_10121616 | 3300005289 | Bacteria | 1763 |
| 6 | Ga0065707_10028976 | 3300005295 | Unclassified | 1361 |
| 7 | Ga0070689_100024949 | 3300005340 | Bacteria | 4488 |
| 8 | Ga0070668_100041057 | 3300005347 | Bacteria | 3543 |
| 9 | Ga0070669_100016468 | 3300005353 | Bacteria | 5274 |
| 10 | Ga0070675_100407727 | 3300005354 | Unclassified | 1213 |
| 11 | Ga0070673_100047734 | 3300005364 | Bacteria | 3333 |
| 12 | Ga0070688_100000902 | 3300005365 | Bacteria | 14816 |
| 13 | Ga0070713_100104414 | 3300005436 | Bacteria | 2460 |
| 14 | Ga0068867_100030816 | 3300005459 | Bacteria | 3869 |
| 15 | Ga0068867_100198986 | 3300005459 | Bacteria | 1603 |
| 16 | Ga0070685_10039168 | 3300005466 | Bacteria | 2691 |
| 17 | Ga0070672_100144036 | 3300005543 | Unclassified | 1968 |
| 18 | Ga0070672_100308363 | 3300005543 | Unclassified | 1343 |
| 19 | Ga0068857_100034931 | 3300005577 | Bacteria | 4449 |
| 20 | Ga0068861_100021013 | 3300005719 | Bacteria | 4687 |
| 21 | Ga0070716_100045737 | 3300006173 | Bacteria | 2459 |
| 22 | Ga0075428_100346036 | 3300006844 | Bacteria | 1596 |
| 23 | Ga0105240_10000037 | 3300009093 | Bacteria | 270462 |
| 24 | Ga0111539_10015908 | 3300009094 | Bacteria | 9343 |
| 25 | Ga0105239_10205143 | 3300010375 | Bacteria | 2209 |
| 26 | Ga0105239_11651651 | 3300010375 | Bacteria | 741 |
| 27 | Ga0157370_10002283 | 3300013104 | Bacteria | 23248 |
| 28 | Ga0157370_10145393 | 3300013104 | Bacteria | 2208 |
| 29 | Ga0163162_10065059 | 3300013306 | Bacteria | 3692 |
| 30 | Ga0163162_10791604 | 3300013306 | Bacteria | 1066 |
| 31 | Ga0157372_10239959 | 3300013307 | Bacteria | 2103 |
| 32 | Ga0157375_10278006 | 3300013308 | Bacteria | 1837 |
| 33 | Ga0157380_10000112 | 3300014326 | Bacteria | 44434 |
| 34 | Ga0157380_10038451 | 3300014326 | Bacteria | 3715 |
| 35 | Ga0157377_10002834 | 3300014745 | Bacteria | 7741 |
| 36 | Ga0163161_10010995 | 3300017792 | Bacteria | 6272 |
| 37 | Ga0163161_10381268 | 3300017792 | Bacteria | 1127 |
| 38 | Ga0207697_10035421 | 3300025315 | Bacteria | 2043 |
| 39 | Ga0207643_10005014 | 3300025908 | Bacteria | 7093 |
| 40 | Ga0207681_10050686 | 3300025923 | Bacteria | 2809 |
| 41 | Ga0207650_10021532 | 3300025925 | Bacteria | 4555 |
| 42 | Ga0207700_10322078 | 3300025928 | Bacteria | 1340 |
| 43 | Ga0207664_10173302 | 3300025929 | Bacteria | 1848 |
| 44 | Ga0207706_10021449 | 3300025933 | Bacteria | 5801 |
| 45 | Ga0207670_10049481 | 3300025936 | Bacteria | 2812 |
| 46 | Ga0207691_10420954 | 3300025940 | Unclassified | 1138 |
| 47 | Ga0207691_10881207 | 3300025940 | Bacteria | 750 |
| 48 | Ga0207689_10083440 | 3300025942 | Bacteria | 2627 |
| 49 | Ga0207651_10669820 | 3300025960 | Unclassified | 912 |
| 50 | Ga0207668_10401607 | 3300025972 | Unclassified | 1159 |
| 51 | Ga0207648_10036884 | 3300026089 | Bacteria | 4306 |
| 52 | Ga0207648_10144865 | 3300026089 | Bacteria | 2095 |
| 53 | Ga0207674_10006163 | 3300026116 | Bacteria | 14164 |
| 54 | Ga0207675_100001073 | 3300026118 | Bacteria | 27154 |
| 55 | Ga0207428_10097161 | 3300027907 | Bacteria | 2280 |
| 56 | Ga0265323_10000021 | 3300028653 | Bacteria | 87631 |
| 57 | Ga0265323_10037158 | 3300028653 | Bacteria | 1786 |
| 58 | Ga0265338_10001166 | 3300028800 | Bacteria | 43408 |
| 59 | Ga0265330_10109617 | 3300031235 | Unclassified | 1180 |
| 60 | Ga0265327_10000026 | 3300031251 | Bacteria | 379288 |
| 61 | Ga0265327_10003714 | 3300031251 | Bacteria | 14221 |
| 62 | Ga0265316_10000989 | 3300031344 | Bacteria | 30846 |
| 63 | Ga0265316_10001858 | 3300031344 | Bacteria | 22219 |
| 64 | Ga0265316_10002580 | 3300031344 | Bacteria | 18719 |
| 65 | Ga0265316_10195474 | 3300031344 | Unclassified | 1501 |
| 66 | Ga0316579_10236008 | 3300031691 | Bacteria | 885 |
| 67 | Ga0265342_10066396 | 3300031712 | Unclassified | 2113 |
| 68 | Ga0316576_10005479 | 3300031727 | Bacteria | 7764 |
| 69 | Ga0316576_10006829 | 3300031727 | Bacteria | 7132 |
| 70 | Ga0316576_10027849 | 3300031727 | Bacteria | 3975 |
| 71 | Ga0316576_10073034 | 3300031727 | Unclassified | 2534 |
| 72 | Ga0316576_10124460 | 3300031727 | Bacteria | 1937 |
| 73 | Ga0316578_10049221 | 3300031728 | Bacteria | 2462 |
| 74 | Ga0316578_10074843 | 3300031728 | Bacteria | 2008 |
| 75 | Ga0316577_10091253 | 3300031733 | Bacteria | 1705 |
| 76 | Ga0307414_10017845 | 3300032004 | Bacteria | 4353 |
| 77 | Ga0307411_10013268 | 3300032005 | Bacteria | 4539 |
| 78 | Ga0316585_10003141 | 3300032137 | Bacteria | 4509 |
| 79 | Ga0316580_10007624 | 3300032139 | Bacteria | 3226 |
| 80 | Ga0316580_10028805 | 3300032139 | Bacteria | 1717 |
| 81 | Ga0316580_10065983 | 3300032139 | Bacteria | 1110 |
| 82 | Ga0316574_0029514 | 3300035398 | Unclassified | 3314 |
| 83 | Ga0316582_0139659 | 3300036647 | Bacteria | 1633 |
| 84 | Ga0316584_0071940 | 3300036712 | Bacteria | 2591 |
| 85 | Ga0316584_0258610 | 3300036712 | Bacteria | 1270 |
| 86 | Ga0395905_0001869 | 3300037471 | Bacteria | 24246 |
| 87 | Ga0395901_0035333 | 3300038443 | Bacteria | 5162 |
| 88 | Ga0400483_102256 | 3300039062 | Bacteria | 3105 |
| 89 | Ga0400483_276446 | 3300039062 | Bacteria | 1305 |
| 90 | Ga0451577_0000048 | 3300042876 | Bacteria | 309377 |
| 91 | Ga0451577_0000317 | 3300042876 | Bacteria | 91191 |
| 92 | Ga0451577_0006262 | 3300042876 | Bacteria | 11923 |
| 93 | Ga0451577_0024395 | 3300042876 | Bacteria | 5502 |
| 94 | Ga0451577_0050655 | 3300042876 | Bacteria | 3707 |
| 95 | Ga0451577_0076389 | 3300042876 | Bacteria | 2986 |
| 96 | Ga0451577_0088486 | 3300042876 | Unclassified | 2763 |
| 97 | Ga0451577_0096195 | 3300042876 | Bacteria | 2644 |
| 98 | Ga0451577_0108208 | 3300042876 | Unclassified | 2485 |
| 99 | Ga0451577_0230982 | 3300042876 | Bacteria | 1673 |
| 100 | Ga0451577_0267956 | 3300042876 | Bacteria | 1547 |
| 101 | Ga0451577_0290852 | 3300042876 | Bacteria | 1480 |
| 102 | Ga0451577_0439331 | 3300042876 | Bacteria | 1185 |
| 103 | Ga0453683_0000010 | 3300044673 | Bacteria | 470890 |
| 104 | Ga0453683_0000078 | 3300044673 | Bacteria | 147056 |
| 105 | Ga0453683_0000105 | 3300044673 | Bacteria | 124993 |
| 106 | Ga0453683_0000504 | 3300044673 | Bacteria | 44527 |
| 107 | Ga0453683_0009591 | 3300044673 | Bacteria | 6457 |
| 108 | Ga0453683_0010525 | 3300044673 | Bacteria | 6125 |
| 109 | Ga0453683_0026387 | 3300044673 | Bacteria | 3689 |
| 110 | Ga0453683_0028710 | 3300044673 | Bacteria | 3521 |
| 111 | Ga0453683_0071242 | 3300044673 | Bacteria | 2174 |
| 112 | Ga0453683_0123474 | 3300044673 | Bacteria | 1630 |
| 113 | Ga0453683_0127062 | 3300044673 | Bacteria | 1605 |
| 114 | Ga0453683_0128852 | 3300044673 | Unclassified | 1594 |
| 115 | Ga0453683_0314680 | 3300044673 | Bacteria | 1002 |
| 116 | Ga0453683_0592890 | 3300044673 | Bacteria | 722 |
| 117 | Ga0453684_0000161 | 3300044712 | Bacteria | 298175 |
| 118 | Ga0453684_0000202 | 3300044712 | Bacteria | 261894 |
| 119 | Ga0453684_0000919 | 3300044712 | Bacteria | 97826 |
| 120 | Ga0453684_0001032 | 3300044712 | Bacteria | 89042 |
| 121 | Ga0453684_0002389 | 3300044712 | Bacteria | 45768 |
| 122 | Ga0453684_0006196 | 3300044712 | Bacteria | 22943 |
| 123 | Ga0453684_0008816 | 3300044712 | Bacteria | 17887 |
| 124 | Ga0453684_0019592 | 3300044712 | Bacteria | 10284 |
| 125 | Ga0453684_0028073 | 3300044712 | Bacteria | 8044 |
| 126 | Ga0453684_0030080 | 3300044712 | Bacteria | 7685 |
| 127 | Ga0453684_0037383 | 3300044712 | Bacteria | 6665 |
| 128 | Ga0453684_0045482 | 3300044712 | Bacteria | 5855 |
| 129 | Ga0453684_0048308 | 3300044712 | Bacteria | 5630 |
| 130 | Ga0453684_0050292 | 3300044712 | Bacteria | 5485 |
| 131 | Ga0453684_0122856 | 3300044712 | Bacteria | 3131 |
| 132 | Ga0453684_0129827 | 3300044712 | Bacteria | 3025 |
| 133 | Ga0453684_0166159 | 3300044712 | Bacteria | 2605 |
| 134 | Ga0453684_0199436 | 3300044712 | Bacteria | 2334 |
| 135 | Ga0453684_0289725 | 3300044712 | Bacteria | 1865 |
| 136 | Ga0453684_0328736 | 3300044712 | Bacteria | 1729 |
| 137 | Ga0453684_0386447 | 3300044712 | Bacteria | 1570 |
| 138 | Ga0453684_0452068 | 3300044712 | Bacteria | 1430 |
| 139 | Ga0453684_0523148 | 3300044712 | Bacteria | 1310 |
| 140 | Ga0453684_0599134 | 3300044712 | Bacteria | 1208 |
| 141 | Ga0453684_0953573 | 3300044712 | Unclassified | 915 |
| 142 | Ga0453684_0997919 | 3300044712 | Unclassified | 891 |
| 143 | Ga0466970_0029066 | 3300044765 | Bacteria | 2908 |
| 144 | Ga0451576_0000059 | 3300045051 | Bacteria | 296795 |
| 145 | Ga0451576_0000232 | 3300045051 | Bacteria | 135846 |
| 146 | Ga0451576_0000389 | 3300045051 | Bacteria | 102554 |
| 147 | Ga0451576_0000830 | 3300045051 | Bacteria | 60243 |
| 148 | Ga0451576_0001257 | 3300045051 | Bacteria | 44542 |
| 149 | Ga0451576_0002323 | 3300045051 | Bacteria | 28799 |
| 150 | Ga0451576_0004943 | 3300045051 | Bacteria | 16969 |
| 151 | Ga0451576_0006466 | 3300045051 | Bacteria | 14362 |
| 152 | Ga0451576_0030262 | 3300045051 | Bacteria | 5788 |
| 153 | Ga0451576_0076600 | 3300045051 | Bacteria | 3480 |
| 154 | Ga0451576_0116720 | 3300045051 | Bacteria | 2778 |
| 155 | Ga0451576_0147684 | 3300045051 | Bacteria | 2451 |
| 156 | Ga0451576_0224891 | 3300045051 | Bacteria | 1960 |
| 157 | Ga0451576_0325413 | 3300045051 | Unclassified | 1609 |
| 158 | Ga0451576_0505862 | 3300045051 | Bacteria | 1269 |
| 159 | Ga0451576_0599741 | 3300045051 | Bacteria | 1157 |
| 160 | Ga0451576_0801043 | 3300045051 | Bacteria | 989 |
| 161 | Ga0451576_1052030 | 3300045051 | Bacteria | 852 |
| 162 | Ga0451576_1432863 | 3300045051 | Bacteria | 718 |
| 163 | Ga0495607_0145711 | 3300046501 | Bacteria | 1217 |
| 164 | Ga0495606_0058003 | 3300046507 | Bacteria | 2491 |
| 165 | Ga0495616_0052150 | 3300046513 | Bacteria | 2037 |
| 166 | Ga0495643_0000506 | 3300046522 | Bacteria | 48801 |
| 167 | Ga0495668_0000078 | 3300046616 | Bacteria | 157809 |
| 168 | Ga0495670_0270841 | 3300046691 | Bacteria | 907 |
| 169 | Ga0495686_0000719 | 3300047472 | Bacteria | 44326 |
| 170 | Ga0496122_0194536 | 3300048925 | Bacteria | 1193 |
| 171 | Ga0501269_002503 | 3300049766 | Unclassified | 2259 |
| 172 | Ga0501269_013864 | 3300049766 | Bacteria | 988 |
| 173 | Ga0501044_0897509 | 3300049823 | Bacteria | 761 |
| 174 | nmdc:mga08y16_102873_c1 | 3300050511 | Bacteria | 2974 |
| 175 | Ga0500641_0000083 | 3300053096 | Bacteria | 37649 |
| 176 | Ga0500616_0002715 | 3300053153 | Bacteria | 14361 |
| 177 | Ga0500627_0021383 | 3300053158 | Bacteria | 2610 |
| 178 | 2881957016 | 2881955468 | Bacteria | 3545609 |
| 179 | 2914761772 | 2914759650 | Bacteria | 4701441 |
| 180 | 2965323457 | 2965320100 | Bacteria | 3975600 |
| 181 | 8036738092 | 8036736890 | Bacteria | 2944828 |
| 182 | Ga0453684_0005862 | |||
| 183 | MBSR1b_contig_741780 | |||
| 184 | MBSR1b_contig_958826 | |||
| 185 | rootH1_10105977 | |||
| 186 | Ga0065704_10121616 | |||
| 187 | Ga0065707_10028976 | |||
| 188 | Ga0070689_100024949 | |||
| 189 | Ga0070668_100041057 | |||
| 190 | Ga0070669_100016468 | |||
| 191 | Ga0070675_100407727 | |||
| 192 | Ga0070673_100047734 | |||
| 193 | Ga0070688_100000902 | |||
| 194 | Ga0070713_100104414 | |||
| 195 | Ga0068867_100030816 | |||
| 196 | Ga0068867_100198986 | |||
| 197 | Ga0070685_10039168 | |||
| 198 | Ga0070672_100144036 | |||
| 199 | Ga0070672_100308363 | |||
| 200 | Ga0068857_100034931 | |||
| 201 | Ga0068861_100021013 | |||
| 202 | Ga0070716_100045737 | |||
| 203 | Ga0075428_100346036 | |||
| 204 | Ga0105240_10000037 | |||
| 205 | Ga0111539_10015908 | |||
| 206 | Ga0105239_10205143 | |||
| 207 | Ga0105239_11651651 | |||
| 208 | Ga0157370_10002283 | |||
| 209 | Ga0157370_10145393 | |||
| 210 | Ga0163162_10065059 | |||
| 211 | Ga0163162_10791604 | |||
| 212 | Ga0157372_10239959 | |||
| 213 | Ga0157375_10278006 | |||
| 214 | Ga0157380_10000112 | |||
| 215 | Ga0157380_10038451 | |||
| 216 | Ga0157377_10002834 | |||
| 217 | Ga0163161_10010995 | |||
| 218 | Ga0163161_10381268 | |||
| 219 | Ga0207697_10035421 | |||
| 220 | Ga0207643_10005014 | |||
| 221 | Ga0207681_10050686 | |||
| 222 | Ga0207650_10021532 | |||
| 223 | Ga0207700_10322078 | |||
| 224 | Ga0207664_10173302 | |||
| 225 | Ga0207706_10021449 | |||
| 226 | Ga0207670_10049481 | |||
| 227 | Ga0207691_10420954 | |||
| 228 | Ga0207691_10881207 | |||
| 229 | Ga0207689_10083440 | |||
| 230 | Ga0207651_10669820 | |||
| 231 | Ga0207668_10401607 | |||
| 232 | Ga0207648_10036884 | |||
| 233 | Ga0207648_10144865 | |||
| 234 | Ga0207674_10006163 | |||
| 235 | Ga0207675_100001073 | |||
| 236 | Ga0207428_10097161 | |||
| 237 | Ga0265323_10000021 | |||
| 238 | Ga0265323_10037158 | |||
| 239 | Ga0265338_10001166 | |||
| 240 | Ga0265330_10109617 | |||
| 241 | Ga0265327_10000026 | |||
| 242 | Ga0265327_10003714 | |||
| 243 | Ga0265316_10000989 | |||
| 244 | Ga0265316_10001858 | |||
| 245 | Ga0265316_10002580 | |||
| 246 | Ga0265316_10195474 | |||
| 247 | Ga0316579_10236008 | |||
| 248 | Ga0265342_10066396 | |||
| 249 | Ga0316576_10005479 | |||
| 250 | Ga0316576_10006829 | |||
| 251 | Ga0316576_10027849 | |||
| 252 | Ga0316576_10073034 | |||
| 253 | Ga0316576_10124460 | |||
| 254 | Ga0316578_10049221 | |||
| 255 | Ga0316578_10074843 | |||
| 256 | Ga0316577_10091253 | |||
| 257 | Ga0307414_10017845 | |||
| 258 | Ga0307411_10013268 | |||
| 259 | Ga0316585_10003141 | |||
| 260 | Ga0316580_10007624 | |||
| 261 | Ga0316580_10028805 | |||
| 262 | Ga0316580_10065983 | |||
| 263 | Ga0316574_0029514 | |||
| 264 | Ga0316582_0139659 | |||
| 265 | Ga0316584_0071940 | |||
| 266 | Ga0316584_0258610 | |||
| 267 | Ga0395905_0001869 | |||
| 268 | Ga0395901_0035333 | |||
| 269 | Ga0400483_102256 | |||
| 270 | Ga0400483_276446 | |||
| 271 | Ga0451577_0000048 | |||
| 272 | Ga0451577_0000317 | |||
| 273 | Ga0451577_0006262 | |||
| 274 | Ga0451577_0024395 | |||
| 275 | Ga0451577_0050655 | |||
| 276 | Ga0451577_0076389 | |||
| 277 | Ga0451577_0088486 | |||
| 278 | Ga0451577_0096195 | |||
| 279 | Ga0451577_0108208 | |||
| 280 | Ga0451577_0230982 | |||
| 281 | Ga0451577_0267956 | |||
| 282 | Ga0451577_0290852 | |||
| 283 | Ga0451577_0439331 | |||
| 284 | Ga0453683_0000010 | |||
| 285 | Ga0453683_0000078 | |||
| 286 | Ga0453683_0000105 | |||
| 287 | Ga0453683_0000504 | |||
| 288 | Ga0453683_0009591 | |||
| 289 | Ga0453683_0010525 | |||
| 290 | Ga0453683_0026387 | |||
| 291 | Ga0453683_0028710 | |||
| 292 | Ga0453683_0071242 | |||
| 293 | Ga0453683_0123474 | |||
| 294 | Ga0453683_0127062 | |||
| 295 | Ga0453683_0128852 | |||
| 296 | Ga0453683_0314680 | |||
| 297 | Ga0453683_0592890 | |||
| 298 | Ga0453684_0000161 | |||
| 299 | Ga0453684_0000202 | |||
| 300 | Ga0453684_0000919 | |||
| 301 | Ga0453684_0001032 | |||
| 302 | Ga0453684_0002389 | |||
| 303 | Ga0453684_0006196 | |||
| 304 | Ga0453684_0008816 | |||
| 305 | Ga0453684_0019592 | |||
| 306 | Ga0453684_0028073 | |||
| 307 | Ga0453684_0030080 | |||
| 308 | Ga0453684_0037383 | |||
| 309 | Ga0453684_0045482 | |||
| 310 | Ga0453684_0048308 | |||
| 311 | Ga0453684_0050292 | |||
| 312 | Ga0453684_0122856 | |||
| 313 | Ga0453684_0129827 | |||
| 314 | Ga0453684_0166159 | |||
| 315 | Ga0453684_0199436 | |||
| 316 | Ga0453684_0289725 | |||
| 317 | Ga0453684_0328736 | |||
| 318 | Ga0453684_0386447 | |||
| 319 | Ga0453684_0452068 | |||
| 320 | Ga0453684_0523148 | |||
| 321 | Ga0453684_0599134 | |||
| 322 | Ga0453684_0953573 | |||
| 323 | Ga0453684_0997919 | |||
| 324 | Ga0466970_0029066 | |||
| 325 | Ga0451576_0000059 | |||
| 326 | Ga0451576_0000232 | |||
| 327 | Ga0451576_0000389 | |||
| 328 | Ga0451576_0000830 | |||
| 329 | Ga0451576_0001257 | |||
| 330 | Ga0451576_0002323 | |||
| 331 | Ga0451576_0004943 | |||
| 332 | Ga0451576_0006466 | |||
| 333 | Ga0451576_0030262 | |||
| 334 | Ga0451576_0076600 | |||
| 335 | Ga0451576_0116720 | |||
| 336 | Ga0451576_0147684 | |||
| 337 | Ga0451576_0224891 | |||
| 338 | Ga0451576_0325413 | |||
| 339 | Ga0451576_0505862 | |||
| 340 | Ga0451576_0599741 | |||
| 341 | Ga0451576_0801043 | |||
| 342 | Ga0451576_1052030 | |||
| 343 | Ga0451576_1432863 | |||
| 344 | Ga0495607_0145711 | |||
| 345 | Ga0495606_0058003 | |||
| 346 | Ga0495616_0052150 | |||
| 347 | Ga0495643_0000506 | |||
| 348 | Ga0495668_0000078 | |||
| 349 | Ga0495670_0270841 | |||
| 350 | Ga0495686_0000719 | |||
| 351 | Ga0496122_0194536 | |||
| 352 | Ga0501269_002503 | |||
| 353 | Ga0501269_013864 | |||
| 354 | Ga0501044_0897509 | |||
| 355 | nmdc:mga08y16_102873_c1 | |||
| 356 | Ga0500641_0000083 | |||
| 357 | Ga0500616_0002715 | |||
| 358 | Ga0500627_0021383 | |||
| 359 | 2881957016 | |||
| 360 | 2914761772 | |||
| 361 | 2965323457 | |||
| 362 | 8036738092 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4o29-assembly1.cif.gz_A | protein-l-isoaspartate o-methyltransferase from pyrobaculum aerophilum in complex with s-adenosyl-l-homocysteine | 0.948 | 7 | 201 |
| 1jg3-assembly1.cif.gz_A | crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with adenosine & vyp(isp)ha substrate | 0.9464 | 7 | 202 |
| 3lbf-assembly4.cif.gz_D | crystal structure of protein l-isoaspartyl methyltransferase from escherichia coli | 0.9431 | 7 | 206 |
| 2yxe-assembly1.cif.gz_B | crystal structure of l-isoaspartyl protein carboxyl methyltranferase | 0.9387 | 6 | 204 |
| 4l7v-assembly1.cif.gz_A | crystal structure of protein l-isoaspartyl-o-methyltransferase of vibrio cholerae | 0.9376 | 7 | 206 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4o29A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.948 | 7 | 201 | 3.40.50.150 |
| 1jg3A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9464 | 7 | 202 | 3.40.50.150 |
| 4l7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9376 | 7 | 206 | 3.40.50.150 |
| 1jg3A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8976 | 7 | 202 | 3.40.50.150 |
| 4o29A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8946 | 7 | 201 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5U112-F1-model_v4 | Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) (PIMT) | 0.9822 | 7 | 206 |
GO:0004719
GO:0005737 GO:0030091 GO:0032259 GO:0036211 |
| AF-A0A2T7BEA5-F1-model_v4 | Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) (PIMT) | 0.9802 | 7 | 206 |
GO:0004719
GO:0005737 GO:0030091 GO:0032259 GO:0036211 |
| AF-A0A6B9ZNS3-F1-model_v4 | Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) (PIMT) | 0.9799 | 7 | 205 |
GO:0004719
GO:0005737 GO:0030091 GO:0032259 GO:0036211 |
| AF-A0A352CK14-F1-model_v4 | Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) | 0.9794 | 7 | 165 |
GO:0004719
GO:0005737 GO:0032259 GO:0036211 |
| AF-A0A2W7RXQ9-F1-model_v4 | Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) (PIMT) | 0.9777 | 7 | 206 |
GO:0004719
GO:0005737 GO:0030091 GO:0032259 GO:0036211 |