F277727

General Info

Members Datasets Scaffolds Average Seq Length
181 119 362 249

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0167324|Ga0395900_0167324_838_1689
Length 283
Sequence LEFLFTIQGCTMVAKEIRLSANATGKTASGGHSAGKGIPGSSRSDPGLRRRELLITTAITLVLSATSARALVIKGSLPWATNAGTPPTAVRPGPWVYFTPEEGAAVEALVDRLIPPDPQTPGGKDAGCAVFIDRQLAGPYGSAEGLYMHGPFADGTPEQGDQSPLTPAARYRQALAALDKHCRAAYAGKPFPQIPDGEKDKVLSGLEKGEVQLEGTSGRAFFEYLLQNTREGFFADPVYGGNRDMVGWKMIGFPGARYDYRDWVERHNERYPLPPVGIAGRPE

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
50 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
72 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
77 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
78 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
79 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
83 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
84 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
85 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
100 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
106 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
107 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
108 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
109 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
110 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
111 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
112 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
113 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
114 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
115 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
116 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
117 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
118 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
119 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.48
Metatranscriptomes 1.66
Isolates 3.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.76
Nodule 3.31
Rhizoplane 4.42
Rhizosphere 86.19
Stem 0
Stem Tuber 0
Unclassified 2.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0167324 3300037418 Bacteria 2240
2 LJNas_1004125 3300000546 Bacteria 1628
3 Ga0070683_100012223 3300005329 Bacteria 7454
4 Ga0070680_100431855 3300005336 Bacteria 1124
5 Ga0070680_100492980 3300005336 Bacteria 1048
6 Ga0070660_100047244 3300005339 Bacteria 3302
7 Ga0070709_10026433 3300005434 Bacteria 3440
8 Ga0070709_10036353 3300005434 Bacteria 2999
9 Ga0070714_100008977 3300005435 Bacteria 7826
10 Ga0070714_100014736 3300005435 Bacteria 6283
11 Ga0070714_100054485 3300005435 Bacteria 3416
12 Ga0070714_100103391 3300005435 Bacteria 2513
13 Ga0070713_100008713 3300005436 Bacteria 7215
14 Ga0070713_100051743 3300005436 Bacteria 3398
15 Ga0070710_10018343 3300005437 Bacteria 3599
16 Ga0070711_100093536 3300005439 Bacteria 2171
17 Ga0070711_100137550 3300005439 Bacteria 1828
18 Ga0070694_100361489 3300005444 Bacteria 1127
19 Ga0070708_100081747 3300005445 Bacteria 2925
20 Ga0070708_100291377 3300005445 Bacteria 1537
21 Ga0070681_10013882 3300005458 Bacteria 8017
22 Ga0070681_10022682 3300005458 Bacteria 6307
23 Ga0070681_10636742 3300005458 Bacteria 981
24 Ga0070706_100022309 3300005467 Bacteria 5829
25 Ga0070707_100166908 3300005468 Bacteria 2145
26 Ga0070707_100169876 3300005468 Bacteria 2125
27 Ga0070698_100030160 3300005471 Bacteria 5626
28 Ga0070699_100007268 3300005518 Bacteria 9639
29 Ga0070699_100076455 3300005518 Bacteria 2914
30 Ga0070679_100001445 3300005530 Bacteria 21012
31 Ga0070684_100221245 3300005535 Bacteria 1727
32 Ga0070697_100017234 3300005536 Bacteria 5680
33 Ga0070697_100091588 3300005536 Bacteria 2514
34 Ga0070695_100003883 3300005545 Bacteria 8719
35 Ga0068855_100000565 3300005563 Bacteria 45485
36 Ga0068855_100055182 3300005563 Bacteria 4668
37 Ga0070664_100158676 3300005564 Bacteria 2000
38 Ga0081455_10007926 3300005937 Bacteria 11114
39 Ga0081540_1007241 3300005983 Bacteria 7951
40 Ga0070717_10030465 3300006028 Bacteria 4335
41 Ga0070717_10041402 3300006028 Bacteria 3755
42 Ga0070717_10130257 3300006028 Bacteria 2163
43 Ga0070717_10239672 3300006028 Bacteria 1599
44 Ga0070717_10263481 3300006028 Bacteria 1525
45 Ga0075432_10106020 3300006058 Bacteria 1043
46 Ga0070715_10001367 3300006163 Bacteria 7038
47 Ga0070715_10264594 3300006163 Bacteria 905
48 Ga0070716_100080980 3300006173 Bacteria 1937
49 Ga0070712_100145985 3300006175 Bacteria 1811
50 Ga0075362_10167974 3300006177 Bacteria 1059
51 Ga0075433_10230226 3300006852 Bacteria 1646
52 Ga0075434_100092534 3300006871 Bacteria 3026
53 Ga0075434_100158469 3300006871 Bacteria 2283
54 Ga0075429_100503108 3300006880 Bacteria 1062
55 Ga0075436_100173794 3300006914 Bacteria 1521
56 Ga0105240_10000760 3300009093 Bacteria 58925
57 Ga0105240_10004576 3300009093 Bacteria 20972
58 Ga0111539_10520383 3300009094 Bacteria 1386
59 Ga0114129_10372148 3300009147 Bacteria 1888
60 Ga0105237_10659165 3300009545 Unclassified 1053
61 Ga0105238_10622204 3300009551 Bacteria 1088
62 Ga0105239_10747834 3300010375 Bacteria 1119
63 Ga0157370_10002806 3300013104 Bacteria 20807
64 Ga0157369_10002484 3300013105 Bacteria 22084
65 Ga0157369_10002969 3300013105 Bacteria 20295
66 Ga0157372_10045094 3300013307 Bacteria 4889
67 Ga0206350_11125704 3300020080 Bacteria 1107
68 Ga0206353_10379021 3300020082 Bacteria 1057
69 Ga0213872_10068801 3300021361 Bacteria 1597
70 Ga0213875_10002669 3300021388 Bacteria 10525
71 Ga0213871_10051625 3300021441 Bacteria 1128
72 Ga0209758_1000913 3300025297 Bacteria 40005
73 Ga0207692_10001209 3300025898 Bacteria 9576
74 Ga0207699_10008656 3300025906 Bacteria 5032
75 Ga0207699_10065089 3300025906 Bacteria 2208
76 Ga0207684_10003027 3300025910 Bacteria 16653
77 Ga0207707_10000897 3300025912 Bacteria 29112
78 Ga0207707_10022735 3300025912 Bacteria 5483
79 Ga0207695_10041114 3300025913 Bacteria 4949
80 Ga0207695_10062934 3300025913 Bacteria 3827
81 Ga0207695_10573233 3300025913 Bacteria 1010
82 Ga0207671_10290246 3300025914 Bacteria 1291
83 Ga0207693_10006477 3300025915 Bacteria 9702
84 Ga0207693_10020159 3300025915 Bacteria 5304
85 Ga0207693_10041591 3300025915 Bacteria 3618
86 Ga0207693_10086843 3300025915 Bacteria 2451
87 Ga0207693_10188099 3300025915 Bacteria 1625
88 Ga0207663_10016980 3300025916 Bacteria 4046
89 Ga0207660_10012837 3300025917 Bacteria 5485
90 Ga0207657_10068707 3300025919 Bacteria 3009
91 Ga0207652_10000579 3300025921 Bacteria 36822
92 Ga0207646_10026389 3300025922 Bacteria 5301
93 Ga0207646_10189082 3300025922 Bacteria 1860
94 Ga0207694_10346851 3300025924 Bacteria 1228
95 Ga0207700_10012609 3300025928 Bacteria 5460
96 Ga0207700_10033110 3300025928 Bacteria 3695
97 Ga0207700_10218615 3300025928 Unclassified 1614
98 Ga0207700_10578314 3300025928 Bacteria 999
99 Ga0207700_10590477 3300025928 Bacteria 988
100 Ga0207664_10053358 3300025929 Bacteria 3199
101 Ga0207664_10159632 3300025929 Bacteria 1922
102 Ga0207664_10181867 3300025929 Unclassified 1805
103 Ga0207664_10304189 3300025929 Bacteria 1403
104 Ga0207665_10003179 3300025939 Bacteria 10995
105 Ga0207665_10017227 3300025939 Bacteria 4746
106 Ga0207667_10023958 3300025949 Bacteria 6715
107 Ga0207667_10078624 3300025949 Bacteria 3419
108 Ga0207667_10111984 3300025949 Bacteria 2815
109 Ga0207639_10267075 3300026041 Bacteria 1499
110 Ga0207702_10063766 3300026078 Bacteria 3152
111 Ga0207702_10363892 3300026078 Unclassified 1387
112 Ga0207702_10369427 3300026078 Bacteria 1377
113 Ga0265763_1004374 3300030763 Bacteria 1155
114 Ga0373945_0146226 3300035116 Bacteria 956
115 Ga0373957_0124124 3300035120 Bacteria 1047
116 Ga0395898_0027975 3300037466 Bacteria 5654
117 Ga0395898_0174032 3300037466 Bacteria 2058
118 Ga0395898_0308300 3300037466 Bacteria 1510
119 Ga0395905_0044359 3300037471 Bacteria 4173
120 Ga0436364_0288306 3300037853 Bacteria 20977
121 Ga0436364_0606844 3300037853 Bacteria 1332
122 Ga0436364_0916294 3300037853 Bacteria 15047
123 Ga0436360_0112947 3300039438 Bacteria 6957
124 Ga0436360_0162069 3300039438 Bacteria 1767
125 Ga0436360_0200302 3300039438 Bacteria 1793
126 Ga0436360_0432099 3300039438 Bacteria 765
127 Ga0436360_1145045 3300039438 Bacteria 6681
128 Ga0436360_1216861 3300039438 Bacteria 4798
129 Ga0436361_0343760 3300039447 Bacteria 1833
130 Ga0436361_0473460 3300039447 Bacteria 1086
131 Ga0436361_0913855 3300039447 Bacteria 1649
132 Ga0436361_1043143 3300039447 Bacteria 823
133 Ga0436363_1386259 3300039450 Bacteria 2534
134 Ga0436362_0432504 3300039453 Bacteria 2016
135 Ga0436362_0915736 3300039453 Bacteria 6971
136 Ga0466969_0019250 3300044656 Bacteria 3552
137 Ga0466966_0003253 3300044684 Bacteria 10710
138 Ga0466966_0039836 3300044684 Bacteria 3025
139 Ga0466961_0002431 3300044693 Bacteria 11554
140 Ga0466963_0160953 3300044694 Bacteria 1562
141 Ga0466964_0000881 3300044706 Bacteria 9842
142 Ga0466971_0000593 3300044719 Bacteria 14350
143 Ga0466959_0006384 3300045049 Bacteria 8162
144 Ga0466959_0316062 3300045049 Bacteria 1068
145 Ga0466958_0111710 3300045836 Bacteria 1706
146 Ga0495651_0235560 3300046462 Bacteria 1258
147 Ga0495651_0276550 3300046462 Bacteria 1136
148 Ga0495653_0033682 3300046463 Bacteria 4056
149 Ga0495652_0096106 3300046529 Bacteria 2413
150 Ga0495587_0057601 3300046536 Bacteria 2284
151 Ga0495623_0192738 3300046679 Bacteria 1176
152 Ga0495680_0049276 3300047322 Bacteria 3300
153 Ga0495602_0095214 3300048088 Bacteria 2459
154 Ga0495602_0159079 3300048088 Bacteria 1766
155 Ga0496104_0047318 3300048907 Bacteria 4054
156 Ga0496106_0102837 3300048909 Bacteria 2217
157 Ga0496108_0012140 3300048911 Bacteria 7005
158 Ga0496108_0309157 3300048911 Bacteria 1377
159 Ga0496109_0061799 3300048912 Unclassified 3425
160 Ga0496109_0645241 3300048912 Bacteria 996
161 Ga0496111_0063834 3300048914 Bacteria 2671
162 Ga0496112_0165550 3300048915 Bacteria 2177
163 Ga0501038_0016672 3300049574 Bacteria 6658
164 Ga0501039_0064925 3300049575 Bacteria 2830
165 Ga0501073_0497995 3300049589 Bacteria 842
166 Ga0501044_0036459 3300049823 Bacteria 5145
167 nmdc:mga03683_188916_c1 3300050489 Bacteria 942
168 nmdc:mga00v17_252648_c1 3300050491 Bacteria 1143
169 nmdc:mga0yw44_133287_c1 3300050492 Bacteria 1610
170 nmdc:mga05p37_193258_c1 3300050507 Bacteria 2469
171 nmdc:mga09592_350577_c1 3300050508 Bacteria 1277
172 nmdc:mga0n895_116850_c1 3300050512 Bacteria 2686
173 nmdc:mga08x19_284448_c1 3300050514 Bacteria 1146
174 Ga0466962_0000344 3300061719 Bacteria 19918
175 2513680089 2513237098 Bacteria 9902361
176 2903775607 2903768456 Bacteria 9749579
177 2933579001 2933577622 Bacteria 9116884
178 2941510105 2941507105 Bacteria 8166816
179 2941518808 2941515067 Bacteria 8166720
180 2941525504 2941523033 Bacteria 8169134
181 8055747360 8055742211 Bacteria 9226248
182 Ga0395900_0167324
183 LJNas_1004125
184 Ga0070683_100012223
185 Ga0070680_100431855
186 Ga0070680_100492980
187 Ga0070660_100047244
188 Ga0070709_10026433
189 Ga0070709_10036353
190 Ga0070714_100008977
191 Ga0070714_100014736
192 Ga0070714_100054485
193 Ga0070714_100103391
194 Ga0070713_100008713
195 Ga0070713_100051743
196 Ga0070710_10018343
197 Ga0070711_100093536
198 Ga0070711_100137550
199 Ga0070694_100361489
200 Ga0070708_100081747
201 Ga0070708_100291377
202 Ga0070681_10013882
203 Ga0070681_10022682
204 Ga0070681_10636742
205 Ga0070706_100022309
206 Ga0070707_100166908
207 Ga0070707_100169876
208 Ga0070698_100030160
209 Ga0070699_100007268
210 Ga0070699_100076455
211 Ga0070679_100001445
212 Ga0070684_100221245
213 Ga0070697_100017234
214 Ga0070697_100091588
215 Ga0070695_100003883
216 Ga0068855_100000565
217 Ga0068855_100055182
218 Ga0070664_100158676
219 Ga0081455_10007926
220 Ga0081540_1007241
221 Ga0070717_10030465
222 Ga0070717_10041402
223 Ga0070717_10130257
224 Ga0070717_10239672
225 Ga0070717_10263481
226 Ga0075432_10106020
227 Ga0070715_10001367
228 Ga0070715_10264594
229 Ga0070716_100080980
230 Ga0070712_100145985
231 Ga0075362_10167974
232 Ga0075433_10230226
233 Ga0075434_100092534
234 Ga0075434_100158469
235 Ga0075429_100503108
236 Ga0075436_100173794
237 Ga0105240_10000760
238 Ga0105240_10004576
239 Ga0111539_10520383
240 Ga0114129_10372148
241 Ga0105237_10659165
242 Ga0105238_10622204
243 Ga0105239_10747834
244 Ga0157370_10002806
245 Ga0157369_10002484
246 Ga0157369_10002969
247 Ga0157372_10045094
248 Ga0206350_11125704
249 Ga0206353_10379021
250 Ga0213872_10068801
251 Ga0213875_10002669
252 Ga0213871_10051625
253 Ga0209758_1000913
254 Ga0207692_10001209
255 Ga0207699_10008656
256 Ga0207699_10065089
257 Ga0207684_10003027
258 Ga0207707_10000897
259 Ga0207707_10022735
260 Ga0207695_10041114
261 Ga0207695_10062934
262 Ga0207695_10573233
263 Ga0207671_10290246
264 Ga0207693_10006477
265 Ga0207693_10020159
266 Ga0207693_10041591
267 Ga0207693_10086843
268 Ga0207693_10188099
269 Ga0207663_10016980
270 Ga0207660_10012837
271 Ga0207657_10068707
272 Ga0207652_10000579
273 Ga0207646_10026389
274 Ga0207646_10189082
275 Ga0207694_10346851
276 Ga0207700_10012609
277 Ga0207700_10033110
278 Ga0207700_10218615
279 Ga0207700_10578314
280 Ga0207700_10590477
281 Ga0207664_10053358
282 Ga0207664_10159632
283 Ga0207664_10181867
284 Ga0207664_10304189
285 Ga0207665_10003179
286 Ga0207665_10017227
287 Ga0207667_10023958
288 Ga0207667_10078624
289 Ga0207667_10111984
290 Ga0207639_10267075
291 Ga0207702_10063766
292 Ga0207702_10363892
293 Ga0207702_10369427
294 Ga0265763_1004374
295 Ga0373945_0146226
296 Ga0373957_0124124
297 Ga0395898_0027975
298 Ga0395898_0174032
299 Ga0395898_0308300
300 Ga0395905_0044359
301 Ga0436364_0288306
302 Ga0436364_0606844
303 Ga0436364_0916294
304 Ga0436360_0112947
305 Ga0436360_0162069
306 Ga0436360_0200302
307 Ga0436360_0432099
308 Ga0436360_1145045
309 Ga0436360_1216861
310 Ga0436361_0343760
311 Ga0436361_0473460
312 Ga0436361_0913855
313 Ga0436361_1043143
314 Ga0436363_1386259
315 Ga0436362_0432504
316 Ga0436362_0915736
317 Ga0466969_0019250
318 Ga0466966_0003253
319 Ga0466966_0039836
320 Ga0466961_0002431
321 Ga0466963_0160953
322 Ga0466964_0000881
323 Ga0466971_0000593
324 Ga0466959_0006384
325 Ga0466959_0316062
326 Ga0466958_0111710
327 Ga0495651_0235560
328 Ga0495651_0276550
329 Ga0495653_0033682
330 Ga0495652_0096106
331 Ga0495587_0057601
332 Ga0495623_0192738
333 Ga0495680_0049276
334 Ga0495602_0095214
335 Ga0495602_0159079
336 Ga0496104_0047318
337 Ga0496106_0102837
338 Ga0496108_0012140
339 Ga0496108_0309157
340 Ga0496109_0061799
341 Ga0496109_0645241
342 Ga0496111_0063834
343 Ga0496112_0165550
344 Ga0501038_0016672
345 Ga0501039_0064925
346 Ga0501073_0497995
347 Ga0501044_0036459
348 nmdc:mga03683_188916_c1
349 nmdc:mga00v17_252648_c1
350 nmdc:mga0yw44_133287_c1
351 nmdc:mga05p37_193258_c1
352 nmdc:mga09592_350577_c1
353 nmdc:mga0n895_116850_c1
354 nmdc:mga08x19_284448_c1
355 Ga0466962_0000344
356 2513680089
357 2903775607
358 2933579001
359 2941510105
360 2941518808
361 2941525504
362 8055747360

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13618

Gluconate_2-dh3

Gluconate 2-dehydrogenase subunit 3

100

255

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f53-assembly1.cif.gz_A top-down design of protein architectures with reinforcement learning 0.3794 130 186
8f53-assembly1.cif.gz_A top-down design of protein architectures with reinforcement learning 0.3515 130 186
6qq5-assembly1.cif.gz_B cryo-em structure of dimeric quinol dependent nitric oxide reductase (qnor) from alcaligenes xylosoxidans 0.3496 52 190
6th6-assembly1.cif.gz_Ai cryo-em structure of t. kodakarensis 70s ribosome 0.2811 82 205
6yr9-assembly2.cif.gz_B focal adhesion kinase catalytic domain in complex with n-methyl-n-(2-{[2-(2-oxo-2,3-dihydro-1h-indol-5-ylamino)-5-trifluoromethyl-pyrimidin-4-ylamino]-methyl}-phenyl)-methanesulfonamide 0.2742 120 201
ID Description Score Start End Superfamily
af_Q8BVE3_8_350_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4314 150 185 1.25.10.10
af_F4IFN6_1472_1848_3.90.1600.10 Alpha Beta;Alpha-Beta Complex;Palm domain of DNA polymerase;B family DNA polymerase, palm domain 0.349 57 181 3.90.1600.10
3ifxC00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3444 124 184 1.10.287.70
3cxbA03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;Secreted effector protein SifA helical domain 0.3369 124 184 1.10.1740.30
af_D3ZHX4_1_59_1.10.8.1020 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecQ-mediated genome instability protein 1, N-terminal domain 0.334 126 185 1.10.8.1020
ID Description Score Start End GO Terms
AF-A0A7G2M0K4-F1-model_v4 Twin-arginine translocation pathway signal protein 0.9403 99 202
AF-A0A535XXT9-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.9193 51 189
AF-M0BN15-F1-model_v4 Gluconate 2-dehydrogenase (Acceptor) 0.9116 50 210
AF-A0A6J4Q664-F1-model_v4 Glucose-methanol-choline (GMC) oxidoreductase:NAD binding site 0.911 44 206 GO:0016614
GO:0050660
AF-A0A7G2M0K4-F1-model_v4 Twin-arginine translocation pathway signal protein 0.9068 99 202

Map