F277671

General Info

Members Datasets Scaffolds Average Seq Length
181 139 362 154

Family's Representative Sequence

Representative Sequence 3300035091|Ga0373951_0000193|Ga0373951_0000193_17605_18105
Length 166
Sequence MIQEGTQAPDFTLKDQNNQEVSLADLRGRKAVLLVFYPLAFTGTCQGELTEIKDNLPLYANSQVQVLTVSVDSAYSHKVWAEREGFEFPLLADFWPHGAVAQAYGVFNEAKGYANRGTFVIDRSGVVRFAEMTGPGEPRDQKAWRAILAEFEHDRMTTPAEAEPGA

Samples

Sample ID Description Type Environment
1 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
10 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
11 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
45 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
46 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
47 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
48 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
49 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
50 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
51 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
61 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
62 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
63 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
64 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
65 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
66 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
67 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
68 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
69 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
76 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
77 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
78 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
79 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
80 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
81 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
82 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
83 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
84 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
89 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
90 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
91 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
92 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
95 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
105 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
108 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
109 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
110 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
111 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
112 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
113 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
114 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
115 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
116 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
117 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
118 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
119 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
120 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
121 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
122 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
123 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
124 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
125 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
126 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
127 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
128 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
129 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
130 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
131 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
132 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
133 2922554459 Rhodococcus sp. 66b Isolate Unclassified
134 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
135 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
136 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
137 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
138 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
139 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.85
Metatranscriptomes 0
Isolates 12.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.39
Nodule 1.1
Rhizoplane 2.21
Rhizosphere 64.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373951_0000193 3300035091 Bacteria 21953
2 JGI24737J22298_10017308 3300001990 Bacteria 2322
3 JGI25406J46586_10038507 3300003203 Bacteria 1713
4 JGI25406J46586_10059312 3300003203 Bacteria 1243
5 JGI25406J46586_10069110 3300003203 Bacteria 1114
6 rootH1_10105172 3300003316 Bacteria 1035
7 Ga0070668_100003333 3300005347 Bacteria 11849
8 Ga0070668_101487440 3300005347 Bacteria 619
9 Ga0070673_100834561 3300005364 Bacteria 852
10 Ga0070667_100477026 3300005367 Bacteria 1142
11 Ga0070665_100613579 3300005548 Bacteria 1101
12 Ga0070665_100881675 3300005548 Bacteria 908
13 Ga0068859_100479872 3300005617 Bacteria 1339
14 Ga0068866_11217005 3300005718 Bacteria 544
15 Ga0068861_100070721 3300005719 Bacteria 2703
16 Ga0068863_100170902 3300005841 Bacteria 2085
17 Ga0068858_100658735 3300005842 Bacteria 1017
18 Ga0068858_101729132 3300005842 Bacteria 618
19 Ga0068860_100276379 3300005843 Bacteria 1640
20 Ga0068860_100395815 3300005843 Bacteria 1366
21 Ga0081540_1034624 3300005983 Bacteria 2719
22 Ga0081539_10002945 3300005985 Bacteria 22399
23 Ga0081539_10011287 3300005985 Bacteria 7094
24 Ga0081539_10028598 3300005985 Bacteria 3501
25 Ga0081539_10096075 3300005985 Bacteria 1521
26 Ga0081539_10155182 3300005985 Bacteria 1097
27 Ga0075365_10325886 3300006038 Bacteria 1082
28 Ga0075432_10297312 3300006058 Bacteria 669
29 Ga0070712_100988174 3300006175 Bacteria 728
30 Ga0075367_10165819 3300006178 Bacteria 1375
31 Ga0097621_100996712 3300006237 Bacteria 783
32 Ga0075370_10009325 3300006353 Bacteria 5093
33 Ga0097620_100479936 3300006931 Bacteria 1339
34 Ga0111539_11770694 3300009094 Bacteria 716
35 Ga0105245_10289267 3300009098 Bacteria 1604
36 Ga0114129_10140520 3300009147 Bacteria 3310
37 Ga0105248_10841669 3300009177 Bacteria 1035
38 Ga0105249_12265175 3300009553 Bacteria 616
39 Ga0157375_10398093 3300013308 Bacteria 1544
40 Ga0182008_10247573 3300014497 Bacteria 919
41 Ga0157379_10500089 3300014968 Bacteria 1127
42 Ga0207647_10186631 3300025904 Bacteria 1203
43 Ga0207660_11003730 3300025917 Bacteria 681
44 Ga0207694_10669063 3300025924 Bacteria 875
45 Ga0207694_10693567 3300025924 Bacteria 859
46 Ga0207687_10820718 3300025927 Bacteria 794
47 Ga0207711_10856606 3300025941 Bacteria 846
48 Ga0207668_10000423 3300025972 Bacteria 26677
49 Ga0207668_10425928 3300025972 Bacteria 1127
50 Ga0207703_10021464 3300026035 Bacteria 5055
51 Ga0207678_10368176 3300026067 Bacteria 1241
52 Ga0207648_10410872 3300026089 Bacteria 1228
53 Ga0207675_101065147 3300026118 Bacteria 828
54 Ga0268266_10177569 3300028379 Bacteria 1937
55 Ga0268266_10862328 3300028379 Bacteria 875
56 Ga0268264_10324725 3300028381 Bacteria 1456
57 Ga0268264_10363816 3300028381 Bacteria 1381
58 Ga0307517_10104325 3300028786 Bacteria 2209
59 Ga0307517_10250957 3300028786 Bacteria 1038
60 Ga0307515_10000549 3300028794 Bacteria 88679
61 Ga0307515_10005482 3300028794 Bacteria 25691
62 Ga0307515_10036777 3300028794 Bacteria 7905
63 Ga0307515_10075513 3300028794 Bacteria 4489
64 Ga0307515_10076864 3300028794 Bacteria 4419
65 Ga0307512_10007680 3300030522 Bacteria 10635
66 Ga0307512_10089670 3300030522 Bacteria 2149
67 Ga0265327_10009454 3300031251 Bacteria 7030
68 Ga0307513_10013014 3300031456 Bacteria 10234
69 Ga0307513_10031295 3300031456 Bacteria 6028
70 Ga0307513_10344005 3300031456 Bacteria 1241
71 Ga0307509_10235941 3300031507 Bacteria 1627
72 Ga0307509_10884122 3300031507 Bacteria 558
73 Ga0307508_10001786 3300031616 Bacteria 23934
74 Ga0307508_10013246 3300031616 Bacteria 7546
75 Ga0307516_10002673 3300031730 Bacteria 23575
76 Ga0307516_10080394 3300031730 Bacteria 3103
77 Ga0307516_10320435 3300031730 Bacteria 1221
78 Ga0307516_10913639 3300031730 Bacteria 545
79 Ga0307405_10178781 3300031731 Bacteria 1521
80 Ga0307410_10040035 3300031852 Bacteria 3082
81 Ga0326468_10002314 3300031889 Bacteria 1590
82 Ga0307406_10032273 3300031901 Bacteria 3196
83 Ga0307406_10200611 3300031901 Bacteria 1468
84 Ga0307406_11035262 3300031901 Bacteria 706
85 Ga0307409_100020633 3300031995 Bacteria 4496
86 Ga0307409_100229428 3300031995 Bacteria 1682
87 Ga0307409_100350030 3300031995 Bacteria 1394
88 Ga0307414_10242111 3300032004 Bacteria 1494
89 Ga0307411_10109414 3300032005 Bacteria 1974
90 Ga0307411_10543250 3300032005 Bacteria 990
91 Ga0307415_100009946 3300032126 Bacteria 5363
92 Ga0307415_100012998 3300032126 Bacteria 4841
93 Ga0307415_100079743 3300032126 Bacteria 2333
94 Ga0307415_100880280 3300032126 Bacteria 824
95 Ga0307507_10175693 3300033179 Bacteria 1544
96 Ga0307507_10175958 3300033179 Bacteria 1542
97 Ga0307510_10261193 3300033180 Bacteria 1213
98 Ga0373938_0032913 3300034957 Bacteria 1119
99 Ga0373928_0052507 3300035084 Bacteria 966
100 Ga0373940_0012146 3300035088 Bacteria 2059
101 Ga0373941_0103519 3300035115 Bacteria 994
102 Ga0373960_0092504 3300035121 Bacteria 969
103 Ga0373942_0002191 3300035207 Bacteria 4808
104 Ga0373962_0004554 3300035242 Bacteria 3354
105 Ga0373935_0051904 3300035692 Bacteria 2605
106 Ga0373927_0085142 3300035695 Bacteria 2051
107 Ga0373925_0328998 3300037068 Bacteria 1238
108 Ga0395900_0350715 3300037418 Bacteria 1449
109 Ga0395898_0181908 3300037466 Bacteria 2009
110 Ga0395905_0309829 3300037471 Bacteria 1467
111 Ga0451789_0500464 3300041443 Bacteria 1093
112 Ga0451791_1494512 3300041451 Bacteria 1995
113 Ga0451798_0192165 3300041458 Bacteria 609
114 Ga0451841_1211031 3300041498 Bacteria 685
115 Ga0451853_0380492 3300041512 Bacteria 2463
116 Ga0451853_4020737 3300041512 Bacteria 819
117 Ga0439463_028451 3300042016 Bacteria 1408
118 Ga0439458_0221464 3300042157 Bacteria 521
119 Ga0466965_0393068 3300044683 Bacteria 765
120 Ga0466963_0014416 3300044694 Bacteria 4873
121 Ga0466971_0279521 3300044719 Bacteria 799
122 Ga0466971_0416374 3300044719 Bacteria 656
123 Ga0466957_0003853 3300044842 Bacteria 8285
124 Ga0466957_0136823 3300044842 Bacteria 1575
125 Ga0466967_1035610 3300045976 Bacteria 817
126 Ga0466967_1850314 3300045976 Bacteria 601
127 Ga0495638_0115335 3300046460 Bacteria 1592
128 Ga0495608_0493453 3300046511 Bacteria 742
129 Ga0495632_0068551 3300046519 Bacteria 1709
130 Ga0495665_0077634 3300046531 Bacteria 1748
131 Ga0495656_0078875 3300046615 Bacteria 1481
132 Ga0495668_0000043 3300046616 Bacteria 227636
133 Ga0495588_0136524 3300046674 Bacteria 1295
134 Ga0495581_0003379 3300047315 Bacteria 9169
135 Ga0495593_0222199 3300047673 Bacteria 948
136 Ga0496112_0818775 3300048915 Bacteria 855
137 Ga0496125_0046662 3300048928 Bacteria 3632
138 Ga0501032_0095028 3300049569 Bacteria 1976
139 Ga0501046_0287146 3300049580 Bacteria 1204
140 Ga0501047_0000018 3300049581 Bacteria 274180
141 Ga0501070_0339960 3300049586 Bacteria 1219
142 Ga0501073_0690763 3300049589 Bacteria 704
143 Ga0501080_1355072 3300049742 Bacteria 608
144 nmdc:mga06z11_75130_c1 3300050494 Bacteria 1798
145 nmdc:mga07m45_52887_c1 3300050496 Bacteria 2294
146 nmdc:mga05p37_93577_c1 3300050507 Bacteria 3369
147 Ga0500583_0146624 3300053092 Bacteria 1174
148 Ga0500583_0467844 3300053092 Bacteria 596
149 Ga0500651_0173217 3300053093 Bacteria 1285
150 Ga0500641_0132080 3300053096 Bacteria 1078
151 Ga0500650_0341012 3300053098 Bacteria 657
152 Ga0500569_010119 3300053109 Bacteria 2211
153 Ga0500594_0055003 3300053118 Bacteria 1131
154 Ga0500652_027000 3300053131 Bacteria 2216
155 Ga0500658_0167895 3300053134 Bacteria 996
156 Ga0500577_0239050 3300053142 Bacteria 788
157 Ga0500579_064969 3300053143 Bacteria 2142
158 Ga0500579_226631 3300053143 Bacteria 642
159 Ga0466962_0229393 3300061719 Bacteria 910
160 2515494972 2515154088 Bacteria 5526283
161 2515757224 2515154137 Bacteria 5711575
162 2516088703 2515154203 Bacteria 5458536
163 2566996925 2565956761 Bacteria 6601618
164 2753271816 2751185782 Bacteria 11227053
165 2772644018 2772190715 Bacteria 6959372
166 2831936482 2831935698 Bacteria 5963223
167 2832005552 2832004796 Bacteria 6538017
168 2866069125 2866065130 Bacteria 6518152
169 2867316306 2867312974 Bacteria 7058875
170 2867321176 2867319477 Bacteria 7069771
171 2867512779 2867507094 Bacteria 6506033
172 2880489474 2880489317 Bacteria 7096270
173 2880496240 2880495981 Bacteria 7340502
174 2904539927 2904535858 Bacteria 6308016
175 2922560501 2922554459 Bacteria 6683962
176 2929224890 2929219909 Bacteria 6984360
177 2929232163 2929226422 Bacteria 7248583
178 8003834557 8003830390 Bacteria 6541657
179 8003873830 8003870546 Bacteria 7396674
180 8054731310 8054727385 Bacteria 7558670
181 8054739771 8054734606 Bacteria 6947278
182 Ga0373951_0000193
183 JGI24737J22298_10017308
184 JGI25406J46586_10038507
185 JGI25406J46586_10059312
186 JGI25406J46586_10069110
187 rootH1_10105172
188 Ga0070668_100003333
189 Ga0070668_101487440
190 Ga0070673_100834561
191 Ga0070667_100477026
192 Ga0070665_100613579
193 Ga0070665_100881675
194 Ga0068859_100479872
195 Ga0068866_11217005
196 Ga0068861_100070721
197 Ga0068863_100170902
198 Ga0068858_100658735
199 Ga0068858_101729132
200 Ga0068860_100276379
201 Ga0068860_100395815
202 Ga0081540_1034624
203 Ga0081539_10002945
204 Ga0081539_10011287
205 Ga0081539_10028598
206 Ga0081539_10096075
207 Ga0081539_10155182
208 Ga0075365_10325886
209 Ga0075432_10297312
210 Ga0070712_100988174
211 Ga0075367_10165819
212 Ga0097621_100996712
213 Ga0075370_10009325
214 Ga0097620_100479936
215 Ga0111539_11770694
216 Ga0105245_10289267
217 Ga0114129_10140520
218 Ga0105248_10841669
219 Ga0105249_12265175
220 Ga0157375_10398093
221 Ga0182008_10247573
222 Ga0157379_10500089
223 Ga0207647_10186631
224 Ga0207660_11003730
225 Ga0207694_10669063
226 Ga0207694_10693567
227 Ga0207687_10820718
228 Ga0207711_10856606
229 Ga0207668_10000423
230 Ga0207668_10425928
231 Ga0207703_10021464
232 Ga0207678_10368176
233 Ga0207648_10410872
234 Ga0207675_101065147
235 Ga0268266_10177569
236 Ga0268266_10862328
237 Ga0268264_10324725
238 Ga0268264_10363816
239 Ga0307517_10104325
240 Ga0307517_10250957
241 Ga0307515_10000549
242 Ga0307515_10005482
243 Ga0307515_10036777
244 Ga0307515_10075513
245 Ga0307515_10076864
246 Ga0307512_10007680
247 Ga0307512_10089670
248 Ga0265327_10009454
249 Ga0307513_10013014
250 Ga0307513_10031295
251 Ga0307513_10344005
252 Ga0307509_10235941
253 Ga0307509_10884122
254 Ga0307508_10001786
255 Ga0307508_10013246
256 Ga0307516_10002673
257 Ga0307516_10080394
258 Ga0307516_10320435
259 Ga0307516_10913639
260 Ga0307405_10178781
261 Ga0307410_10040035
262 Ga0326468_10002314
263 Ga0307406_10032273
264 Ga0307406_10200611
265 Ga0307406_11035262
266 Ga0307409_100020633
267 Ga0307409_100229428
268 Ga0307409_100350030
269 Ga0307414_10242111
270 Ga0307411_10109414
271 Ga0307411_10543250
272 Ga0307415_100009946
273 Ga0307415_100012998
274 Ga0307415_100079743
275 Ga0307415_100880280
276 Ga0307507_10175693
277 Ga0307507_10175958
278 Ga0307510_10261193
279 Ga0373938_0032913
280 Ga0373928_0052507
281 Ga0373940_0012146
282 Ga0373941_0103519
283 Ga0373960_0092504
284 Ga0373942_0002191
285 Ga0373962_0004554
286 Ga0373935_0051904
287 Ga0373927_0085142
288 Ga0373925_0328998
289 Ga0395900_0350715
290 Ga0395898_0181908
291 Ga0395905_0309829
292 Ga0451789_0500464
293 Ga0451791_1494512
294 Ga0451798_0192165
295 Ga0451841_1211031
296 Ga0451853_0380492
297 Ga0451853_4020737
298 Ga0439463_028451
299 Ga0439458_0221464
300 Ga0466965_0393068
301 Ga0466963_0014416
302 Ga0466971_0279521
303 Ga0466971_0416374
304 Ga0466957_0003853
305 Ga0466957_0136823
306 Ga0466967_1035610
307 Ga0466967_1850314
308 Ga0495638_0115335
309 Ga0495608_0493453
310 Ga0495632_0068551
311 Ga0495665_0077634
312 Ga0495656_0078875
313 Ga0495668_0000043
314 Ga0495588_0136524
315 Ga0495581_0003379
316 Ga0495593_0222199
317 Ga0496112_0818775
318 Ga0496125_0046662
319 Ga0501032_0095028
320 Ga0501046_0287146
321 Ga0501047_0000018
322 Ga0501070_0339960
323 Ga0501073_0690763
324 Ga0501080_1355072
325 nmdc:mga06z11_75130_c1
326 nmdc:mga07m45_52887_c1
327 nmdc:mga05p37_93577_c1
328 Ga0500583_0146624
329 Ga0500583_0467844
330 Ga0500651_0173217
331 Ga0500641_0132080
332 Ga0500650_0341012
333 Ga0500569_010119
334 Ga0500594_0055003
335 Ga0500652_027000
336 Ga0500658_0167895
337 Ga0500577_0239050
338 Ga0500579_064969
339 Ga0500579_226631
340 Ga0466962_0229393
341 2515494972
342 2515757224
343 2516088703
344 2566996925
345 2753271816
346 2772644018
347 2831936482
348 2832005552
349 2866069125
350 2867316306
351 2867321176
352 2867512779
353 2880489474
354 2880496240
355 2904539927
356 2922560501
357 2929224890
358 2929232163
359 8003834557
360 8003873830
361 8054731310
362 8054739771

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

5

130

0.99

PF08534

Redoxin

Redoxin

3

147

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9908 1 151
5id2-assembly1.cif.gz_B asymmetry in the active site of mycobacterium tuberculosis ahpe upon exposure to mycothiol 0.9903 1 151
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9843 1 151
5id2-assembly1.cif.gz_B asymmetry in the active site of mycobacterium tuberculosis ahpe upon exposure to mycothiol 0.9838 1 151
4xih-assembly1.cif.gz_B-2 crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis 0.9713 1 151
ID Description Score Start End Superfamily
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9903 1 151 3.40.30.10
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9838 1 151 3.40.30.10
af_Q54W30_4_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.929 2 150 3.40.30.10
3drnB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9236 2 150 3.40.30.10
af_Q55E48_3_135_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9203 1 133 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2W6C6W8-F1-model_v4 Peroxiredoxin 0.9961 1 151 GO:0016209
GO:0016491
AF-A0A7R7HW98-F1-model_v4 Peroxiredoxin 0.9953 2 151 GO:0016209
GO:0016491
AF-A0A810L824-F1-model_v4 Thioredoxin domain-containing protein 0.9952 2 151 GO:0016209
GO:0016491
AF-A0A538N2J3-F1-model_v4 Peroxiredoxin 0.995 2 151 GO:0016209
GO:0016491
AF-A0A1G9DGJ9-F1-model_v4 Peroxiredoxin 0.9949 2 151 GO:0016209
GO:0016491

Map