F277633

General Info

Members Datasets Scaffolds Average Seq Length
181 117 362 166

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10457726|Ga0316576_104577261
Length 194
Sequence MMMGWAAGNGAAAGASQGEAGWLCSRGSEPMSKTLLVMRHAKSSWKDASLSDHDRPLNKRGRTAAPRMGELIRDQGILPDYIATSSALRARATAEAVADACGYSGTIRELCELYLAPPAAYVQAVRGIDTDLGRVLVVGHNPGITQLVCELARADEVMPTGALALIELPIRRWADLDFGVSGQLMRLWRPRELD

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
22 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
54 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
55 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
56 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
57 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
64 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
65 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
66 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
67 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
72 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
73 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
74 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
75 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
76 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
77 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
82 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
83 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
84 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
85 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
86 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
87 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
88 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
89 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
91 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
92 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
93 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
94 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
95 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
96 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
97 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
98 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
99 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
100 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
101 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
102 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
103 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
104 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
105 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
106 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
107 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
108 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
111 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
117 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 1.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.1
Rhizosphere 98.9
Stem 0
Stem Tuber 0
Unclassified 23.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10457726 3300031727 Bacteria 942
2 SwRhRL3b_contig_1581789 2162886006 Archaea 1631
3 Ga0065704_10009750 3300005289 Unclassified 1888
4 Ga0065704_10025367 3300005289 Archaea 1805
5 Ga0065704_10080544 3300005289 Bacteria 3919
6 Ga0065707_10000181 3300005295 Archaea 1893
7 Ga0065707_10138017 3300005295 Archaea 1787
8 Ga0070692_10282305 3300005345 Bacteria 1007
9 Ga0070714_100798158 3300005435 Unclassified 914
10 Ga0070694_100066096 3300005444 Bacteria 2480
11 Ga0070694_100117907 3300005444 Unclassified 1901
12 Ga0070708_100014852 3300005445 Bacteria 6419
13 Ga0070708_100116728 3300005445 Bacteria 2458
14 Ga0070706_101813898 3300005467 Unclassified 554
15 Ga0070698_100268755 3300005471 Unclassified 1637
16 Ga0070699_100198156 3300005518 Archaea 1785
17 Ga0070697_100231242 3300005536 Archaea 1577
18 Ga0070695_100100761 3300005545 Unclassified 1945
19 Ga0070695_100109074 3300005545 Unclassified 1875
20 Ga0070696_100459933 3300005546 Unclassified 1006
21 Ga0070693_100025785 3300005547 Bacteria 3166
22 Ga0070693_100130050 3300005547 Bacteria 1573
23 Ga0070665_100169699 3300005548 Bacteria 2183
24 Ga0068856_100017627 3300005614 Bacteria 6921
25 Ga0068861_100002145 3300005719 Bacteria 12769
26 Ga0081455_10004340 3300005937 Archaea 15955
27 Ga0081455_10178220 3300005937 Archaea 1612
28 Ga0081538_10009644 3300005981 Bacteria 8026
29 Ga0081538_10238344 3300005981 Unclassified 704
30 Ga0075432_10032347 3300006058 Archaea 1813
31 Ga0075427_10023005 3300006194 Archaea 997
32 Ga0075428_100009829 3300006844 Bacteria 10632
33 Ga0075428_100121045 3300006844 Archaea 2850
34 Ga0075431_100081132 3300006847 Archaea 3349
35 Ga0075431_100776566 3300006847 Bacteria 932
36 Ga0075433_10093626 3300006852 Unclassified 2658
37 Ga0075433_10104208 3300006852 Archaea 2513
38 Ga0075434_100180061 3300006871 Unclassified 2133
39 Ga0075434_100420022 3300006871 Archaea 1358
40 Ga0075434_101572282 3300006871 Unclassified 666
41 Ga0075429_100059221 3300006880 Archaea 3335
42 Ga0075429_100087670 3300006880 Archaea 2712
43 Ga0075429_100099630 3300006880 Archaea 2535
44 Ga0075429_100842883 3300006880 Archaea 802
45 Ga0075435_100156200 3300007076 Archaea 1919
46 Ga0111539_10139654 3300009094 Archaea 2837
47 Ga0111539_10148184 3300009094 Archaea 2747
48 Ga0111539_11316307 3300009094 Archaea 838
49 Ga0114129_10116730 3300009147 Archaea 3678
50 Ga0114129_10311920 3300009147 Archaea 2093
51 Ga0114129_10416760 3300009147 Archaea 1767
52 Ga0114129_10819753 3300009147 Bacteria 1185
53 Ga0114129_11482626 3300009147 Unclassified 834
54 Ga0105241_10023321 3300009174 Bacteria 4589
55 Ga0105241_10301018 3300009174 Bacteria 1376
56 Ga0105248_10008882 3300009177 Bacteria 11045
57 Ga0105237_11501555 3300009545 Unclassified 680
58 Ga0105238_10000347 3300009551 Bacteria 49819
59 Ga0105249_10595514 3300009553 Bacteria 1160
60 Ga0105239_11461213 3300010375 Bacteria 790
61 Ga0105246_11219024 3300011119 Bacteria 693
62 Ga0105246_11823237 3300011119 Unclassified 582
63 Ga0157373_10100020 3300013100 Bacteria 2041
64 Ga0157374_10130380 3300013296 Bacteria 2433
65 Ga0157378_10094901 3300013297 Bacteria 2716
66 Ga0157372_10372305 3300013307 Unclassified 1664
67 Ga0157380_10011133 3300014326 Bacteria 6489
68 Ga0207684_10192037 3300025910 Bacteria 1761
69 Ga0207654_10024462 3300025911 Bacteria 3247
70 Ga0207646_10391280 3300025922 Unclassified 1256
71 Ga0207694_10007365 3300025924 Bacteria 8347
72 Ga0207711_10010237 3300025941 Bacteria 7785
73 Ga0207639_10093089 3300026041 Unclassified 2416
74 Ga0207675_100003714 3300026118 Bacteria 14870
75 Ga0207428_10005422 3300027907 Archaea 11899
76 Ga0207428_10102125 3300027907 Archaea 2215
77 Ga0207428_10724545 3300027907 Archaea 710
78 Ga0268266_10300091 3300028379 Bacteria 1498
79 Ga0307408_100023261 3300031548 Bacteria 4219
80 Ga0316575_10022879 3300031665 Bacteria 2413
81 Ga0316579_10000470 3300031691 Bacteria 13040
82 Ga0316579_10070415 3300031691 Bacteria 1656
83 Ga0316576_10012129 3300031727 Bacteria 5684
84 Ga0316576_10014278 3300031727 Bacteria 5304
85 Ga0316576_10038805 3300031727 Bacteria 3417
86 Ga0316576_10045845 3300031727 Bacteria 3163
87 Ga0316576_10083459 3300031727 Bacteria 2373
88 Ga0316576_10222127 3300031727 Bacteria 1421
89 Ga0316576_10272937 3300031727 Bacteria 1267
90 Ga0316578_10000025 3300031728 Bacteria 29963
91 Ga0316578_10300500 3300031728 Unclassified 960
92 Ga0316578_10528549 3300031728 Bacteria 694
93 Ga0307405_10530203 3300031731 Bacteria 949
94 Ga0316577_10023415 3300031733 Unclassified 3429
95 Ga0316577_10040472 3300031733 Bacteria 2606
96 Ga0316577_10234255 3300031733 Bacteria 1038
97 Ga0307413_11065797 3300031824 Unclassified 696
98 Ga0307410_10154774 3300031852 Bacteria 1711
99 Ga0307407_10033135 3300031903 Bacteria 2816
100 Ga0307409_100026222 3300031995 Unclassified 4106
101 Ga0307416_100133761 3300032002 Bacteria 2238
102 Ga0307415_100033752 3300032126 Bacteria 3323
103 Ga0307415_100105673 3300032126 Bacteria 2077
104 Ga0316583_10000129 3300032133 Bacteria 17653
105 Ga0316585_10000016 3300032137 Bacteria 25117
106 Ga0316580_10000127 3300032139 Bacteria 14527
107 Ga0316592_1046793 3300033524 Unclassified 963
108 Ga0316596_1036823 3300033541 Bacteria 1279
109 Ga0316574_0000260 3300035398 Bacteria 19401
110 Ga0316574_0036426 3300035398 Bacteria 3012
111 Ga0316574_0045477 3300035398 Bacteria 2719
112 Ga0316582_0049461 3300036647 Bacteria 2659
113 Ga0316582_0056192 3300036647 Unclassified 2510
114 Ga0316582_0329076 3300036647 Unclassified 1051
115 Ga0316584_0051890 3300036712 Bacteria 3067
116 Ga0316584_0059766 3300036712 Bacteria 2854
117 Ga0316584_0075209 3300036712 Bacteria 2531
118 Ga0316584_0921874 3300036712 Unclassified 587
119 Ga0316581_0004245 3300037588 Bacteria 3642
120 Ga0316581_0052169 3300037588 Bacteria 1253
121 Ga0439448_0009035 3300042005 Archaea 2931
122 Ga0439451_014574 3300042009 Archaea 1586
123 Ga0439463_013895 3300042016 Archaea 1984
124 Ga0439464_0023060 3300042439 Archaea 1717
125 Ga0439440_0033331 3300042993 Archaea 1227
126 Ga0453684_0337423 3300044712 Bacteria 1703
127 Ga0495603_0094156 3300046455 Bacteria 1750
128 Ga0495603_0138865 3300046455 Bacteria 1414
129 Ga0495653_0488786 3300046463 Unclassified 769
130 Ga0495639_0602457 3300046475 Bacteria 565
131 Ga0495659_0165128 3300046664 Archaea 896
132 Ga0495670_0082715 3300046691 Archaea 1637
133 Ga0496104_0268293 3300048907 Bacteria 1619
134 Ga0496112_1187178 3300048915 Unclassified 680
135 Ga0501292_008230 3300049515 Bacteria 1520
136 Ga0501296_000615 3300049519 Bacteria 3493
137 Ga0501296_001698 3300049519 Bacteria 2244
138 Ga0501300_026621 3300049523 Unclassified 849
139 Ga0501041_0380707 3300049577 Bacteria 893
140 Ga0501071_0486401 3300049587 Bacteria 946
141 Ga0501076_0249938 3300049592 Bacteria 1451
142 Ga0501207_029523 3300049654 Unclassified 916
143 Ga0501216_005262 3300049660 Bacteria 1943
144 Ga0501217_009955 3300049661 Unclassified 2075
145 Ga0501227_104045 3300049665 Unclassified 757
146 Ga0501233_002794 3300049668 Unclassified 3100
147 Ga0501235_016404 3300049669 Bacteria 1636
148 Ga0501249_095410 3300049679 Unclassified 709
149 Ga0501225_0014138 3300049705 Unclassified 2230
150 Ga0501225_0030204 3300049705 Unclassified 1490
151 Ga0501234_011853 3300049707 Bacteria 1364
152 Ga0501245_003757 3300049708 Unclassified 2073
153 Ga0501079_0495091 3300049741 Bacteria 961
154 Ga0501266_055129 3300049763 Unclassified 623
155 Ga0501273_013858 3300049770 Unclassified 1032
156 Ga0501275_006710 3300049772 Bacteria 1139
157 Ga0501282_010960 3300049778 Unclassified 974
158 Ga0501283_001447 3300049779 Bacteria 3082
159 Ga0501212_014168 3300049851 Bacteria 1177
160 nmdc:mga05p37_140112_c1 3300050507 Archaea 2964
161 nmdc:mga05p37_1530783_c1 3300050507 Bacteria 662
162 nmdc:mga05p37_209869_c1 3300050507 Archaea 2355
163 nmdc:mga05p37_211582_c1 3300050507 Archaea 2344
164 nmdc:mga05p37_38817_c2 3300050507 Archaea 4126
165 nmdc:mga09592_180375_c1 3300050508 Archaea 1827
166 nmdc:mga0qj67_123960_c1 3300050509 Archaea 2091
167 nmdc:mga0qj67_191593_c1 3300050509 Archaea 1662
168 nmdc:mga06r32_1095631_c1 3300050510 Bacteria 746
169 nmdc:mga06r32_162359_c1 3300050510 Archaea 2217
170 nmdc:mga06r32_1790628_c1 3300050510 Unclassified 550
171 nmdc:mga06r32_609060_c1 3300050510 Archaea 1063
172 nmdc:mga08y16_147606_c1 3300050511 Archaea 2445
173 nmdc:mga08y16_585174_c1 3300050511 Bacteria 1126
174 nmdc:mga08y16_72116_c1 3300050511 Archaea 3599
175 nmdc:mga0n895_26014_c1 3300050512 Archaea 5536
176 nmdc:mga0n895_416215_c1 3300050512 Unclassified 1359
177 nmdc:mga0rr50_437743_c1 3300050513 Unclassified 1107
178 nmdc:mga08x19_27085_c1 3300050514 Bacteria 3583
179 nmdc:mga0a205_15373_c1 3300050515 Archaea 7154
180 nmdc:mga0a205_26317_c1 3300050515 Bacteria 5546
181 nmdc:mga0a205_83029_c1 3300050515 Archaea 3095
182 Ga0316576_10457726
183 SwRhRL3b_contig_1581789
184 Ga0065704_10009750
185 Ga0065704_10025367
186 Ga0065704_10080544
187 Ga0065707_10000181
188 Ga0065707_10138017
189 Ga0070692_10282305
190 Ga0070714_100798158
191 Ga0070694_100066096
192 Ga0070694_100117907
193 Ga0070708_100014852
194 Ga0070708_100116728
195 Ga0070706_101813898
196 Ga0070698_100268755
197 Ga0070699_100198156
198 Ga0070697_100231242
199 Ga0070695_100100761
200 Ga0070695_100109074
201 Ga0070696_100459933
202 Ga0070693_100025785
203 Ga0070693_100130050
204 Ga0070665_100169699
205 Ga0068856_100017627
206 Ga0068861_100002145
207 Ga0081455_10004340
208 Ga0081455_10178220
209 Ga0081538_10009644
210 Ga0081538_10238344
211 Ga0075432_10032347
212 Ga0075427_10023005
213 Ga0075428_100009829
214 Ga0075428_100121045
215 Ga0075431_100081132
216 Ga0075431_100776566
217 Ga0075433_10093626
218 Ga0075433_10104208
219 Ga0075434_100180061
220 Ga0075434_100420022
221 Ga0075434_101572282
222 Ga0075429_100059221
223 Ga0075429_100087670
224 Ga0075429_100099630
225 Ga0075429_100842883
226 Ga0075435_100156200
227 Ga0111539_10139654
228 Ga0111539_10148184
229 Ga0111539_11316307
230 Ga0114129_10116730
231 Ga0114129_10311920
232 Ga0114129_10416760
233 Ga0114129_10819753
234 Ga0114129_11482626
235 Ga0105241_10023321
236 Ga0105241_10301018
237 Ga0105248_10008882
238 Ga0105237_11501555
239 Ga0105238_10000347
240 Ga0105249_10595514
241 Ga0105239_11461213
242 Ga0105246_11219024
243 Ga0105246_11823237
244 Ga0157373_10100020
245 Ga0157374_10130380
246 Ga0157378_10094901
247 Ga0157372_10372305
248 Ga0157380_10011133
249 Ga0207684_10192037
250 Ga0207654_10024462
251 Ga0207646_10391280
252 Ga0207694_10007365
253 Ga0207711_10010237
254 Ga0207639_10093089
255 Ga0207675_100003714
256 Ga0207428_10005422
257 Ga0207428_10102125
258 Ga0207428_10724545
259 Ga0268266_10300091
260 Ga0307408_100023261
261 Ga0316575_10022879
262 Ga0316579_10000470
263 Ga0316579_10070415
264 Ga0316576_10012129
265 Ga0316576_10014278
266 Ga0316576_10038805
267 Ga0316576_10045845
268 Ga0316576_10083459
269 Ga0316576_10222127
270 Ga0316576_10272937
271 Ga0316578_10000025
272 Ga0316578_10300500
273 Ga0316578_10528549
274 Ga0307405_10530203
275 Ga0316577_10023415
276 Ga0316577_10040472
277 Ga0316577_10234255
278 Ga0307413_11065797
279 Ga0307410_10154774
280 Ga0307407_10033135
281 Ga0307409_100026222
282 Ga0307416_100133761
283 Ga0307415_100033752
284 Ga0307415_100105673
285 Ga0316583_10000129
286 Ga0316585_10000016
287 Ga0316580_10000127
288 Ga0316592_1046793
289 Ga0316596_1036823
290 Ga0316574_0000260
291 Ga0316574_0036426
292 Ga0316574_0045477
293 Ga0316582_0049461
294 Ga0316582_0056192
295 Ga0316582_0329076
296 Ga0316584_0051890
297 Ga0316584_0059766
298 Ga0316584_0075209
299 Ga0316584_0921874
300 Ga0316581_0004245
301 Ga0316581_0052169
302 Ga0439448_0009035
303 Ga0439451_014574
304 Ga0439463_013895
305 Ga0439464_0023060
306 Ga0439440_0033331
307 Ga0453684_0337423
308 Ga0495603_0094156
309 Ga0495603_0138865
310 Ga0495653_0488786
311 Ga0495639_0602457
312 Ga0495659_0165128
313 Ga0495670_0082715
314 Ga0496104_0268293
315 Ga0496112_1187178
316 Ga0501292_008230
317 Ga0501296_000615
318 Ga0501296_001698
319 Ga0501300_026621
320 Ga0501041_0380707
321 Ga0501071_0486401
322 Ga0501076_0249938
323 Ga0501207_029523
324 Ga0501216_005262
325 Ga0501217_009955
326 Ga0501227_104045
327 Ga0501233_002794
328 Ga0501235_016404
329 Ga0501249_095410
330 Ga0501225_0014138
331 Ga0501225_0030204
332 Ga0501234_011853
333 Ga0501245_003757
334 Ga0501079_0495091
335 Ga0501266_055129
336 Ga0501273_013858
337 Ga0501275_006710
338 Ga0501282_010960
339 Ga0501283_001447
340 Ga0501212_014168
341 nmdc:mga05p37_140112_c1
342 nmdc:mga05p37_1530783_c1
343 nmdc:mga05p37_209869_c1
344 nmdc:mga05p37_211582_c1
345 nmdc:mga05p37_38817_c2
346 nmdc:mga09592_180375_c1
347 nmdc:mga0qj67_123960_c1
348 nmdc:mga0qj67_191593_c1
349 nmdc:mga06r32_1095631_c1
350 nmdc:mga06r32_162359_c1
351 nmdc:mga06r32_1790628_c1
352 nmdc:mga06r32_609060_c1
353 nmdc:mga08y16_147606_c1
354 nmdc:mga08y16_585174_c1
355 nmdc:mga08y16_72116_c1
356 nmdc:mga0n895_26014_c1
357 nmdc:mga0n895_416215_c1
358 nmdc:mga0rr50_437743_c1
359 nmdc:mga08x19_27085_c1
360 nmdc:mga0a205_15373_c1
361 nmdc:mga0a205_26317_c1
362 nmdc:mga0a205_83029_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

35

114

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rfl-assembly7.cif.gz_G crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8998 6 163
2rfl-assembly3.cif.gz_C crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8878 6 163
2rfl-assembly7.cif.gz_G crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8774 6 163
2rfl-assembly2.cif.gz_B crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8762 6 163
2rfl-assembly5.cif.gz_E crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8751 6 163
ID Description Score Start End Superfamily
af_I1L079_52_229_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8891 5 163 3.40.50.1240
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8752 7 167 3.40.50.1240
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8647 7 167 3.40.50.1240
af_P9WGF9_1_158_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8613 12 163 3.40.50.1240
2rflF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8353 6 162 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A7X3WJ50-F1-model_v4 Histidine phosphatase family protein 0.9946 5 165
AF-A0A7X3NZ62-F1-model_v4 Histidine phosphatase family protein 0.9944 25 164
AF-A0A2E7D089-F1-model_v4 Phosphohistidine phosphatase 0.9941 6 166
AF-A0A7C7HGP4-F1-model_v4 Histidine phosphatase family protein 0.9938 6 167
AF-A0A7Z9WUF3-F1-model_v4 Histidine phosphatase family protein 0.9924 4 167

Map