F277192

General Info

Members Datasets Scaffolds Average Seq Length
181 130 362 108

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100006404|Ga0075429_10000640410
Length 129
Sequence MDRSAPARDLGYSRAVSKLTTHVLDTSRGAPAAGVLVTLEVRDPDGAWSSRGGGVTDADGRLRTLLPGDAALPAGVYRLTFDVAAYFGAAGVASFFPSVAITFEVRDADQHHHVPLLLSPFSYTTYRGS

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
40 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
78 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
96 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
97 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
100 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
101 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
102 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
124 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
125 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
126 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
129 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
130 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 1.1
Rhizosphere 97.24
Stem 0
Stem Tuber 0
Unclassified 12.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100006404 3300006880 Bacteria 10190
2 JGI24737J22298_10018051 3300001990 Bacteria 2268
3 rootH1_10061132 3300003323 Bacteria 4860
4 Ga0070683_100007456 3300005329 Bacteria 9243
5 Ga0070683_102035253 3300005329 Bacteria 552
6 Ga0070670_100151789 3300005331 Unclassified 2005
7 Ga0068868_100130783 3300005338 Bacteria 2054
8 Ga0070714_100905262 3300005435 Bacteria 857
9 Ga0070701_10072901 3300005438 Bacteria 1840
10 Ga0070701_10413606 3300005438 Unclassified 857
11 Ga0070711_100566579 3300005439 Bacteria 944
12 Ga0070705_100054217 3300005440 Bacteria 2351
13 Ga0070684_100001947 3300005535 Bacteria 15150
14 Ga0070684_100131383 3300005535 Bacteria 2259
15 Ga0070684_100990562 3300005535 Bacteria 789
16 Ga0070686_100932428 3300005544 Unclassified 708
17 Ga0070695_101392179 3300005545 Bacteria 581
18 Ga0070665_100320936 3300005548 Bacteria 1553
19 Ga0070665_101473240 3300005548 Bacteria 689
20 Ga0070664_102040865 3300005564 Bacteria 544
21 Ga0068857_100202936 3300005577 Bacteria 1807
22 Ga0068856_100369757 3300005614 Bacteria 1453
23 Ga0068856_100732277 3300005614 Bacteria 1009
24 Ga0070702_100444548 3300005615 Bacteria 939
25 Ga0068852_101491826 3300005616 Bacteria 698
26 Ga0068859_100181788 3300005617 Bacteria 2186
27 Ga0068864_101349156 3300005618 Unclassified 714
28 Ga0068866_10877534 3300005718 Unclassified 629
29 Ga0068861_100376375 3300005719 Bacteria 1253
30 Ga0068863_102621848 3300005841 Unclassified 513
31 Ga0068858_100015585 3300005842 Bacteria 7149
32 Ga0068858_102262883 3300005842 Bacteria 537
33 Ga0068862_101663087 3300005844 Bacteria 646
34 Ga0097621_101643163 3300006237 Bacteria 611
35 Ga0075428_100032834 3300006844 Bacteria 5732
36 Ga0075428_100040054 3300006844 Bacteria 5156
37 Ga0075430_100022545 3300006846 Bacteria 5359
38 Ga0075431_100009454 3300006847 Bacteria 9787
39 Ga0075433_10128064 3300006852 Bacteria 2255
40 Ga0075429_100048917 3300006880 Bacteria 3677
41 Ga0075429_100464292 3300006880 Bacteria 1109
42 Ga0075436_100249162 3300006914 Bacteria 1264
43 Ga0097620_100181800 3300006931 Bacteria 2186
44 Ga0075435_100589745 3300007076 Bacteria 963
45 Ga0105245_10440723 3300009098 Bacteria 1309
46 Ga0105245_10573950 3300009098 Unclassified 1152
47 Ga0105245_10736360 3300009098 Unclassified 1021
48 Ga0114129_10024833 3300009147 Bacteria 8495
49 Ga0114129_10314115 3300009147 Bacteria 2085
50 Ga0105242_10282018 3300009176 Unclassified 1509
51 Ga0105238_10375040 3300009551 Bacteria 1413
52 Ga0105030_112533 3300009987 Bacteria 737
53 Ga0105028_101975 3300009993 Bacteria 2149
54 Ga0105028_106599 3300009993 Bacteria 1212
55 Ga0157371_11120034 3300013102 Bacteria 604
56 Ga0157369_10642758 3300013105 Bacteria 1094
57 Ga0157369_11587132 3300013105 Unclassified 665
58 Ga0157372_10640048 3300013307 Bacteria 1238
59 Ga0157372_10795169 3300013307 Unclassified 1099
60 Ga0157375_12056252 3300013308 Bacteria 679
61 Ga0163163_12675802 3300014325 Bacteria 556
62 Ga0157380_10592083 3300014326 Bacteria 1096
63 Ga0157376_10357986 3300014969 Unclassified 1399
64 Ga0206353_10071677 3300020082 Bacteria 744
65 Ga0207647_10048384 3300025904 Bacteria 2641
66 Ga0207671_10589300 3300025914 Bacteria 886
67 Ga0207660_10201713 3300025917 Bacteria 1554
68 Ga0207649_10843580 3300025920 Bacteria 717
69 Ga0207652_10485148 3300025921 Bacteria 1113
70 Ga0207694_10661303 3300025924 Bacteria 880
71 Ga0207664_10354227 3300025929 Bacteria 1299
72 Ga0207661_10031456 3300025944 Bacteria 4100
73 Ga0207661_10070827 3300025944 Bacteria 2847
74 Ga0207661_10267490 3300025944 Bacteria 1525
75 Ga0207667_11446905 3300025949 Bacteria 660
76 Ga0207677_11255374 3300026023 Bacteria 679
77 Ga0207703_10011197 3300026035 Bacteria 6978
78 Ga0207703_11144801 3300026035 Unclassified 748
79 Ga0207703_11585711 3300026035 Bacteria 630
80 Ga0207702_10801658 3300026078 Bacteria 931
81 Ga0207674_10312733 3300026116 Bacteria 1520
82 Ga0207675_100859936 3300026118 Bacteria 922
83 Ga0207675_101403948 3300026118 Bacteria 719
84 Ga0207683_11453117 3300026121 Bacteria 633
85 Ga0268266_10259174 3300028379 Bacteria 1611
86 Ga0268265_11004780 3300028380 Bacteria 824
87 Ga0265320_10185607 3300031240 Unclassified 931
88 Ga0265329_10177893 3300031242 Unclassified 695
89 Ga0307408_100826564 3300031548 Bacteria 843
90 Ga0265314_10146055 3300031711 Bacteria 1457
91 Ga0265314_10329185 3300031711 Bacteria 847
92 Ga0307516_10689494 3300031730 Unclassified 678
93 Ga0307406_10312011 3300031901 Bacteria 1213
94 Ga0307406_10804624 3300031901 Bacteria 793
95 Ga0307406_11019207 3300031901 Bacteria 711
96 Ga0307407_10576601 3300031903 Bacteria 835
97 Ga0307409_100088448 3300031995 Bacteria 2529
98 Ga0307409_100414815 3300031995 Bacteria 1290
99 Ga0307409_100945231 3300031995 Bacteria 878
100 Ga0307409_101056649 3300031995 Bacteria 832
101 Ga0307416_100646358 3300032002 Bacteria 1142
102 Ga0307416_100876207 3300032002 Bacteria 997
103 Ga0307414_10518255 3300032004 Bacteria 1058
104 Ga0307415_100530090 3300032126 Bacteria 1035
105 Ga0373955_1057807 3300035172 Unclassified 500
106 Ga0373933_0204173 3300035724 Bacteria 1265
107 Ga0395900_0378899 3300037418 Bacteria 1383
108 Ga0395898_0142117 3300037466 Bacteria 2298
109 Ga0395901_0002532 3300038443 Bacteria 18526
110 Ga0439464_0190856 3300042439 Bacteria 651
111 Ga0466965_0361096 3300044683 Bacteria 797
112 Ga0466965_0836447 3300044683 Bacteria 534
113 Ga0466966_0928822 3300044684 Bacteria 525
114 Ga0466963_0059058 3300044694 Bacteria 2559
115 Ga0466963_0141004 3300044694 Bacteria 1670
116 Ga0466964_0318062 3300044706 Bacteria 790
117 Ga0466971_0107967 3300044719 Bacteria 1283
118 Ga0466971_0178397 3300044719 Bacteria 998
119 Ga0466970_0115613 3300044765 Bacteria 1467
120 Ga0466957_0532722 3300044842 Bacteria 817
121 Ga0466957_1336061 3300044842 Bacteria 521
122 Ga0466960_0120175 3300044901 Bacteria 1375
123 Ga0466960_0192746 3300044901 Bacteria 1110
124 Ga0466960_0672240 3300044901 Bacteria 619
125 Ga0466960_0821146 3300044901 Bacteria 564
126 Ga0466960_1011481 3300044901 Bacteria 511
127 Ga0466959_0059252 3300045049 Bacteria 2788
128 Ga0466959_0134711 3300045049 Bacteria 1749
129 Ga0466959_0589413 3300045049 Bacteria 748
130 Ga0451576_1804469 3300045051 Unclassified 632
131 Ga0466958_0059198 3300045836 Bacteria 2330
132 Ga0466958_0112173 3300045836 Bacteria 1702
133 Ga0466967_0009582 3300045976 Bacteria 7198
134 Ga0466967_0040518 3300045976 Bacteria 4011
135 Ga0466967_0743109 3300045976 Bacteria 973
136 Ga0495590_0149303 3300046457 Bacteria 847
137 Ga0495607_0339597 3300046501 Bacteria 696
138 Ga0495618_0687956 3300046514 Unclassified 602
139 Ga0495628_0640435 3300046516 Unclassified 756
140 Ga0495609_0184247 3300046538 Bacteria 878
141 Ga0495621_0028192 3300046539 Bacteria 1908
142 Ga0495588_0657215 3300046674 Unclassified 548
143 Ga0495636_0047861 3300047318 Bacteria 1786
144 Ga0495674_1332644 3300047319 Bacteria 537
145 Ga0496106_0656087 3300048909 Bacteria 838
146 Ga0496113_1129702 3300048916 Bacteria 614
147 Ga0501031_0350398 3300049568 Bacteria 956
148 Ga0501031_0396833 3300049568 Bacteria 892
149 Ga0501036_0597627 3300049572 Bacteria 915
150 Ga0501041_1003751 3300049577 Bacteria 537
151 Ga0501046_0487750 3300049580 Bacteria 884
152 Ga0501048_0539511 3300049582 Bacteria 837
153 Ga0501071_0077113 3300049587 Bacteria 2434
154 Ga0501074_0011781 3300049590 Bacteria 6357
155 Ga0501074_0750215 3300049590 Bacteria 688
156 Ga0501075_0507917 3300049591 Bacteria 920
157 Ga0501076_0032910 3300049592 Bacteria 4048
158 Ga0501079_0159519 3300049741 Bacteria 1758
159 Ga0501081_0135935 3300049743 Bacteria 1759
160 Ga0501083_0001371 3300049744 Bacteria 16530
161 Ga0501035_0462201 3300049822 Bacteria 1049
162 nmdc:mga05p37_14868_c1 3300050507 Bacteria 9348
163 nmdc:mga09592_10508_c1 3300050508 Bacteria 7532
164 nmdc:mga09592_647914_c1 3300050508 Bacteria 902
165 nmdc:mga0qj67_445270_c1 3300050509 Unclassified 1044
166 nmdc:mga06r32_101529_c1 3300050510 Bacteria 2823
167 nmdc:mga06r32_490765_c1 3300050510 Bacteria 1206
168 nmdc:mga06r32_549745_c1 3300050510 Bacteria 1129
169 nmdc:mga08x19_112394_c1 3300050514 Bacteria 1818
170 nmdc:mga0a205_240579_c1 3300050515 Bacteria 1691
171 Ga0495655_0152942 3300053083 Bacteria 727
172 Ga0500568_0000196 3300053139 Bacteria 52926
173 Ga0501084_0076268 3300054114 Bacteria 2810
174 Ga0501082_0457508 3300060353 Bacteria 1115
175 Ga0501082_0875401 3300060353 Bacteria 786
176 Ga0501082_0922014 3300060353 Bacteria 764
177 Ga0466962_0121788 3300061719 Bacteria 1259
178 Ga0466962_0234870 3300061719 Bacteria 899
179 Ga0530510_0149161 3300061734 Bacteria 1726
180 Ga0530510_0311550 3300061734 Bacteria 1179
181 Ga0530510_1198156 3300061734 Bacteria 582
182 Ga0075429_100006404
183 JGI24737J22298_10018051
184 rootH1_10061132
185 Ga0070683_100007456
186 Ga0070683_102035253
187 Ga0070670_100151789
188 Ga0068868_100130783
189 Ga0070714_100905262
190 Ga0070701_10072901
191 Ga0070701_10413606
192 Ga0070711_100566579
193 Ga0070705_100054217
194 Ga0070684_100001947
195 Ga0070684_100131383
196 Ga0070684_100990562
197 Ga0070686_100932428
198 Ga0070695_101392179
199 Ga0070665_100320936
200 Ga0070665_101473240
201 Ga0070664_102040865
202 Ga0068857_100202936
203 Ga0068856_100369757
204 Ga0068856_100732277
205 Ga0070702_100444548
206 Ga0068852_101491826
207 Ga0068859_100181788
208 Ga0068864_101349156
209 Ga0068866_10877534
210 Ga0068861_100376375
211 Ga0068863_102621848
212 Ga0068858_100015585
213 Ga0068858_102262883
214 Ga0068862_101663087
215 Ga0097621_101643163
216 Ga0075428_100032834
217 Ga0075428_100040054
218 Ga0075430_100022545
219 Ga0075431_100009454
220 Ga0075433_10128064
221 Ga0075429_100048917
222 Ga0075429_100464292
223 Ga0075436_100249162
224 Ga0097620_100181800
225 Ga0075435_100589745
226 Ga0105245_10440723
227 Ga0105245_10573950
228 Ga0105245_10736360
229 Ga0114129_10024833
230 Ga0114129_10314115
231 Ga0105242_10282018
232 Ga0105238_10375040
233 Ga0105030_112533
234 Ga0105028_101975
235 Ga0105028_106599
236 Ga0157371_11120034
237 Ga0157369_10642758
238 Ga0157369_11587132
239 Ga0157372_10640048
240 Ga0157372_10795169
241 Ga0157375_12056252
242 Ga0163163_12675802
243 Ga0157380_10592083
244 Ga0157376_10357986
245 Ga0206353_10071677
246 Ga0207647_10048384
247 Ga0207671_10589300
248 Ga0207660_10201713
249 Ga0207649_10843580
250 Ga0207652_10485148
251 Ga0207694_10661303
252 Ga0207664_10354227
253 Ga0207661_10031456
254 Ga0207661_10070827
255 Ga0207661_10267490
256 Ga0207667_11446905
257 Ga0207677_11255374
258 Ga0207703_10011197
259 Ga0207703_11144801
260 Ga0207703_11585711
261 Ga0207702_10801658
262 Ga0207674_10312733
263 Ga0207675_100859936
264 Ga0207675_101403948
265 Ga0207683_11453117
266 Ga0268266_10259174
267 Ga0268265_11004780
268 Ga0265320_10185607
269 Ga0265329_10177893
270 Ga0307408_100826564
271 Ga0265314_10146055
272 Ga0265314_10329185
273 Ga0307516_10689494
274 Ga0307406_10312011
275 Ga0307406_10804624
276 Ga0307406_11019207
277 Ga0307407_10576601
278 Ga0307409_100088448
279 Ga0307409_100414815
280 Ga0307409_100945231
281 Ga0307409_101056649
282 Ga0307416_100646358
283 Ga0307416_100876207
284 Ga0307414_10518255
285 Ga0307415_100530090
286 Ga0373955_1057807
287 Ga0373933_0204173
288 Ga0395900_0378899
289 Ga0395898_0142117
290 Ga0395901_0002532
291 Ga0439464_0190856
292 Ga0466965_0361096
293 Ga0466965_0836447
294 Ga0466966_0928822
295 Ga0466963_0059058
296 Ga0466963_0141004
297 Ga0466964_0318062
298 Ga0466971_0107967
299 Ga0466971_0178397
300 Ga0466970_0115613
301 Ga0466957_0532722
302 Ga0466957_1336061
303 Ga0466960_0120175
304 Ga0466960_0192746
305 Ga0466960_0672240
306 Ga0466960_0821146
307 Ga0466960_1011481
308 Ga0466959_0059252
309 Ga0466959_0134711
310 Ga0466959_0589413
311 Ga0451576_1804469
312 Ga0466958_0059198
313 Ga0466958_0112173
314 Ga0466967_0009582
315 Ga0466967_0040518
316 Ga0466967_0743109
317 Ga0495590_0149303
318 Ga0495607_0339597
319 Ga0495618_0687956
320 Ga0495628_0640435
321 Ga0495609_0184247
322 Ga0495621_0028192
323 Ga0495588_0657215
324 Ga0495636_0047861
325 Ga0495674_1332644
326 Ga0496106_0656087
327 Ga0496113_1129702
328 Ga0501031_0350398
329 Ga0501031_0396833
330 Ga0501036_0597627
331 Ga0501041_1003751
332 Ga0501046_0487750
333 Ga0501048_0539511
334 Ga0501071_0077113
335 Ga0501074_0011781
336 Ga0501074_0750215
337 Ga0501075_0507917
338 Ga0501076_0032910
339 Ga0501079_0159519
340 Ga0501081_0135935
341 Ga0501083_0001371
342 Ga0501035_0462201
343 nmdc:mga05p37_14868_c1
344 nmdc:mga09592_10508_c1
345 nmdc:mga09592_647914_c1
346 nmdc:mga0qj67_445270_c1
347 nmdc:mga06r32_101529_c1
348 nmdc:mga06r32_490765_c1
349 nmdc:mga06r32_549745_c1
350 nmdc:mga08x19_112394_c1
351 nmdc:mga0a205_240579_c1
352 Ga0495655_0152942
353 Ga0500568_0000196
354 Ga0501084_0076268
355 Ga0501082_0457508
356 Ga0501082_0875401
357 Ga0501082_0922014
358 Ga0466962_0121788
359 Ga0466962_0234870
360 Ga0530510_0149161
361 Ga0530510_0311550
362 Ga0530510_1198156

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00576

Transthyretin

HIUase/Transthyretin family

19

128

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2igl-assembly1.cif.gz_C crystal structure of e. coli yedx, a transthyretin related protein 0.9567 4 108
3qva-assembly1.cif.gz_D structure of klebsiella pneumoniae 5-hydroxyisourate hydrolase 0.953 4 108
2gpz-assembly1.cif.gz_A transthyretin-like protein from salmonella dublin 0.9458 4 108
3qva-assembly1.cif.gz_A structure of klebsiella pneumoniae 5-hydroxyisourate hydrolase 0.9357 1 108
3do4-assembly2.cif.gz_B crystal structure of transthyretin variant t60a at acidic ph 0.9337 4 107
ID Description Score Start End Superfamily
af_O44578_18_134_2.60.40.180 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9553 2 106 2.60.40.180
3qvaD00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.953 4 108 2.60.40.180
2gpzC00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9458 4 108 2.60.40.180
af_O74492_5_124_2.60.40.180 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9336 4 108 2.60.40.180
3qvaD00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9264 4 108 2.60.40.180
ID Description Score Start End GO Terms
AF-A0A0R3PXU8-F1-model_v4 TR_THY domain-containing protein 0.9876 49 108 GO:0006144
AF-K9BFX6-F1-model_v4 5-hydroxyisourate hydrolase (HIU hydrolase) (HIUHase) (EC 3.5.2.17) 0.9828 1 108 GO:0006144
GO:0033971
AF-A0A6D0J280-F1-model_v4 deleted 0.9824 51 108
AF-A0A2X1QIP7-F1-model_v4 Transthyretin family protein (EC 3.5.2.17) 0.9812 51 108 GO:0006144
GO:0033971
AF-A0A379U244-F1-model_v4 5-hydroxyisourate hydrolase (HIU hydrolase) (HIUHase) (EC 3.5.2.17) 0.9807 49 108 GO:0006144
GO:0033971

Map