F277143

General Info

Members Datasets Scaffolds Average Seq Length
181 111 362 226

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100009799|Ga0075428_10000979910
Length 257
Sequence MSGVDDSWEARVQAVAALEEPTRRRLYAHVISQARPVTRDEAAAALGLPRTTAAFHLDRLADDGLLDVAFERRTGRSGPGAGRPSKLYRRSDRHLVVSLPERRYDVAGRLLAAAVDDAESSGDSPRAALDRRAHRLGTQLGEAARAADGEASDQDAVLRTLEQHGFEPRAEGSGIVLGNCPFHILAQEYTDLVCTMNLCLLDGLLTGLGHTDLRAHLDRGPGRCCVRLEPRQDRASGATPQVGQAHTDRPVGPDRER

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
29 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
30 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
31 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
32 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
33 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
34 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
35 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
36 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
37 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
38 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
39 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
40 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
41 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
42 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
43 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
44 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
45 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
46 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
47 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
48 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
49 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
50 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
51 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
52 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
53 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
54 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
55 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
56 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
57 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
58 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
59 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
60 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
61 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
62 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
63 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
64 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
65 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
66 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
69 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
70 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
71 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
72 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
86 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
87 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
88 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
89 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
90 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
91 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
92 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
93 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
94 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
95 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
96 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
97 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
98 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
99 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
104 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
105 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
107 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
108 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
109 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
110 2808606372 Agromyces sp. 23-23 Isolate Unclassified
111 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.24
Metatranscriptomes 1.1
Isolates 1.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.21
Rhizosphere 96.69
Stem 0
Stem Tuber 0
Unclassified 7.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100009799 3300006844 Bacteria 10648
2 JGI24740J21852_10029882 3300001979 Bacteria 1783
3 JGI24739J22299_10007859 3300001989 Bacteria 3990
4 rootH1_10122432 3300003323 Unclassified 1246
5 JGI25407J50210_10001400 3300003373 Bacteria 5468
6 Ga0065714_10216401 3300005288 Bacteria 852
7 Ga0070658_10002124 3300005327 Bacteria 16641
8 Ga0070683_100150153 3300005329 Bacteria 2209
9 Ga0070670_100473791 3300005331 Bacteria 1111
10 Ga0070668_100377757 3300005347 Bacteria 1205
11 Ga0070679_100212732 3300005530 Bacteria 1897
12 Ga0070684_100253088 3300005535 Bacteria 1610
13 Ga0068855_100793333 3300005563 Bacteria 1007
14 Ga0081538_10000047 3300005981 Bacteria 112562
15 Ga0075428_100021681 3300006844 Bacteria 7113
16 Ga0075430_100002171 3300006846 Bacteria 16245
17 Ga0075431_100008012 3300006847 Bacteria 10540
18 Ga0075429_100075992 3300006880 Bacteria 2925
19 Ga0114129_10025629 3300009147 Bacteria 8354
20 Ga0114129_10591585 3300009147 Bacteria 1439
21 Ga0105028_101009 3300009993 Bacteria 2963
22 Ga0157369_10321257 3300013105 Bacteria 1609
23 Ga0206353_10559063 3300020082 Bacteria 804
24 Ga0206353_10909384 3300020082 Bacteria 9132
25 Ga0207647_10004674 3300025904 Bacteria 10144
26 Ga0207705_10032969 3300025909 Bacteria 3702
27 Ga0207707_10105988 3300025912 Bacteria 2457
28 Ga0207652_10130856 3300025921 Bacteria 2238
29 Ga0207652_10437814 3300025921 Bacteria 1179
30 Ga0207650_10313235 3300025925 Bacteria 1284
31 Ga0207650_10321706 3300025925 Bacteria 1267
32 Ga0207674_10222312 3300026116 Bacteria 1836
33 Ga0307408_100585042 3300031548 Bacteria 990
34 Ga0307413_10242416 3300031824 Bacteria 1332
35 Ga0307410_10029792 3300031852 Bacteria 3480
36 Ga0307406_10067360 3300031901 Bacteria 2334
37 Ga0307409_100160805 3300031995 Bacteria 1964
38 Ga0307409_100381604 3300031995 Bacteria 1340
39 Ga0307416_100180284 3300032002 Bacteria 1979
40 Ga0307416_100312499 3300032002 Bacteria 1569
41 Ga0307416_100822640 3300032002 Bacteria 1026
42 Ga0307416_100984350 3300032002 Bacteria 946
43 Ga0307414_10134523 3300032004 Bacteria 1925
44 Ga0307414_10245917 3300032004 Bacteria 1484
45 Ga0307411_10446646 3300032005 Unclassified 1081
46 Ga0307415_100128761 3300032126 Bacteria 1912
47 Ga0307415_100291707 3300032126 Bacteria 1347
48 Ga0307415_100375254 3300032126 Bacteria 1206
49 Ga0307415_100376511 3300032126 Bacteria 1204
50 Ga0395900_0012422 3300037418 Bacteria 8709
51 Ga0395900_0061264 3300037418 Bacteria 3869
52 Ga0395898_0123957 3300037466 Bacteria 2476
53 Ga0439436_0067793 3300041404 Bacteria 995
54 Ga0439439_0014151 3300041406 Unclassified 1940
55 Ga0439447_045623 3300041407 Archaea 1057
56 Ga0439466_0030833 3300041411 Unclassified 1836
57 Ga0439431_0098133 3300041997 Bacteria 803
58 Ga0439433_0034123 3300041999 Unclassified 1170
59 Ga0439442_013986 3300042002 Unclassified 1650
60 Ga0439432_000702 3300042006 Bacteria 12536
61 Ga0439449_0081869 3300042007 Unclassified 1190
62 Ga0439457_035272 3300042014 Unclassified 1112
63 Ga0439462_0004462 3300042015 Bacteria 3417
64 Ga0450919_003489 3300042121 Unclassified 1961
65 Ga0450920_000295 3300042122 Bacteria 7557
66 Ga0450920_000764 3300042122 Bacteria 5176
67 Ga0450920_020941 3300042122 Bacteria 1261
68 Ga0439446_0021367 3300042156 Unclassified 1829
69 Ga0450908_001868 3300042184 Bacteria 4121
70 Ga0450909_001198 3300042185 Bacteria 3598
71 Ga0439434_0001070 3300042435 Bacteria 7932
72 Ga0466969_0072505 3300044656 Bacteria 1654
73 Ga0466965_0061872 3300044683 Bacteria 1872
74 Ga0466965_0161601 3300044683 Bacteria 1175
75 Ga0466965_0172557 3300044683 Bacteria 1138
76 Ga0466965_0311021 3300044683 Unclassified 857
77 Ga0466966_0027095 3300044684 Bacteria 3738
78 Ga0466966_0127135 3300044684 Bacteria 1562
79 Ga0466966_0387215 3300044684 Bacteria 840
80 Ga0466963_0222244 3300044694 Bacteria 1323
81 Ga0466963_0242325 3300044694 Bacteria 1265
82 Ga0466964_0161136 3300044706 Unclassified 1049
83 Ga0466971_0143654 3300044719 Bacteria 1112
84 Ga0466970_0072025 3300044765 Bacteria 1859
85 Ga0466957_0068416 3300044842 Bacteria 2192
86 Ga0466960_0132079 3300044901 Bacteria 1319
87 Ga0466960_0158120 3300044901 Bacteria 1215
88 Ga0466960_0215472 3300044901 Bacteria 1054
89 Ga0466959_0141373 3300045049 Bacteria 1701
90 Ga0466959_0284599 3300045049 Bacteria 1134
91 Ga0466959_0367261 3300045049 Bacteria 980
92 Ga0466958_0390520 3300045836 Bacteria 898
93 Ga0466967_0010624 3300045976 Bacteria 6918
94 Ga0466967_0078588 3300045976 Bacteria 2972
95 Ga0466967_0091872 3300045976 Bacteria 2759
96 Ga0466967_0264776 3300045976 Bacteria 1645
97 Ga0466967_0548834 3300045976 Bacteria 1137
98 Ga0495656_0033388 3300046615 Bacteria 2100
99 Ga0496102_0065939 3300048905 Bacteria 3319
100 Ga0496109_0585687 3300048912 Unclassified 1051
101 Ga0496114_0017319 3300048917 Bacteria 5815
102 Ga0496114_0303328 3300048917 Unclassified 1410
103 Ga0501031_0037587 3300049568 Bacteria 3159
104 Ga0501031_0164249 3300049568 Bacteria 1451
105 Ga0501032_0084001 3300049569 Bacteria 2117
106 Ga0501034_0008322 3300049571 Bacteria 10976
107 Ga0501034_0023529 3300049571 Bacteria 6276
108 Ga0501034_0111847 3300049571 Bacteria 2721
109 Ga0501036_0012963 3300049572 Bacteria 6920
110 Ga0501036_0037112 3300049572 Bacteria 4122
111 Ga0501036_0265904 3300049572 Bacteria 1436
112 Ga0501037_0061094 3300049573 Bacteria 2748
113 Ga0501038_0003134 3300049574 Bacteria 15425
114 Ga0501038_0098027 3300049574 Bacteria 2445
115 Ga0501038_0282878 3300049574 Bacteria 1305
116 Ga0501040_0004110 3300049576 Bacteria 9464
117 Ga0501040_0060965 3300049576 Bacteria 2593
118 Ga0501040_0090137 3300049576 Bacteria 2131
119 Ga0501041_0007420 3300049577 Bacteria 6437
120 Ga0501041_0008380 3300049577 Bacteria 6078
121 Ga0501042_0003228 3300049578 Bacteria 10189
122 Ga0501042_0029819 3300049578 Bacteria 3848
123 Ga0501043_0007196 3300049579 Bacteria 8843
124 Ga0501043_0091380 3300049579 Bacteria 2393
125 Ga0501046_0044396 3300049580 Bacteria 3535
126 Ga0501046_0231641 3300049580 Bacteria 1364
127 Ga0501047_0007227 3300049581 Bacteria 10438
128 Ga0501047_0098651 3300049581 Bacteria 2800
129 Ga0501048_0001237 3300049582 Bacteria 19359
130 Ga0501048_0135907 3300049582 Bacteria 1737
131 Ga0501068_0093621 3300049584 Bacteria 1856
132 Ga0501068_0229994 3300049584 Bacteria 1179
133 Ga0501069_0003623 3300049585 Bacteria 7956
134 Ga0501069_0029311 3300049585 Bacteria 3020
135 Ga0501070_0052294 3300049586 Bacteria 3390
136 Ga0501070_0077424 3300049586 Bacteria 2753
137 Ga0501070_0376382 3300049586 Bacteria 1150
138 Ga0501071_0124857 3300049587 Bacteria 1909
139 Ga0501072_0043339 3300049588 Bacteria 3536
140 Ga0501073_0066479 3300049589 Bacteria 2513
141 Ga0501073_0070785 3300049589 Bacteria 2430
142 Ga0501074_0001381 3300049590 Bacteria 16103
143 Ga0501075_0007393 3300049591 Bacteria 7620
144 Ga0501075_0070923 3300049591 Bacteria 2633
145 Ga0501075_0164592 3300049591 Bacteria 1692
146 Ga0501076_0002225 3300049592 Bacteria 13298
147 Ga0501076_0024984 3300049592 Bacteria 4621
148 Ga0501076_0282946 3300049592 Bacteria 1359
149 Ga0501076_0328139 3300049592 Bacteria 1255
150 Ga0501077_0001325 3300049593 Bacteria 14946
151 Ga0501077_0125844 3300049593 Bacteria 1624
152 Ga0501079_0032950 3300049741 Bacteria 3984
153 Ga0501079_0232857 3300049741 Bacteria 1439
154 Ga0501080_0000490 3300049742 Bacteria 30857
155 Ga0501080_0051017 3300049742 Bacteria 3849
156 Ga0501081_0006635 3300049743 Bacteria 7523
157 Ga0501081_0031332 3300049743 Bacteria 3604
158 Ga0501083_0033818 3300049744 Bacteria 3498
159 Ga0501083_0035815 3300049744 Bacteria 3390
160 Ga0501035_0061028 3300049822 Bacteria 3356
161 Ga0501035_0485619 3300049822 Bacteria 1018
162 Ga0501044_0338455 3300049823 Bacteria 1426
163 Ga0501045_0046900 3300049824 Bacteria 3146
164 nmdc:mga05p37_189615_c1 3300050507 Bacteria 2497
165 nmdc:mga05p37_36024_c1 3300050507 Bacteria 6071
166 nmdc:mga09592_94961_c1 3300050508 Bacteria 2550
167 nmdc:mga0qj67_252570_c1 3300050509 Bacteria 1431
168 Ga0501084_0028371 3300054114 Bacteria 4678
169 Ga0501084_0086589 3300054114 Bacteria 2630
170 Ga0501082_0007910 3300060353 Bacteria 9181
171 Ga0501082_0105751 3300060353 Bacteria 2435
172 Ga0501082_0199670 3300060353 Bacteria 1740
173 Ga0501082_0239321 3300060353 Bacteria 1579
174 Ga0501082_0391677 3300060353 Bacteria 1212
175 Ga0466962_0042879 3300061719 Bacteria 2166
176 Ga0466962_0094913 3300061719 Bacteria 1430
177 Ga0530510_0183208 3300061734 Bacteria 1553
178 Ga0530510_0504632 3300061734 Bacteria 917
179 2587864070 2585428094 Bacteria 3604039
180 2808901229 2808606372 Bacteria 4649509
181 2816424950 2816332119 Bacteria 8120218
182 Ga0075428_100009799
183 JGI24740J21852_10029882
184 JGI24739J22299_10007859
185 rootH1_10122432
186 JGI25407J50210_10001400
187 Ga0065714_10216401
188 Ga0070658_10002124
189 Ga0070683_100150153
190 Ga0070670_100473791
191 Ga0070668_100377757
192 Ga0070679_100212732
193 Ga0070684_100253088
194 Ga0068855_100793333
195 Ga0081538_10000047
196 Ga0075428_100021681
197 Ga0075430_100002171
198 Ga0075431_100008012
199 Ga0075429_100075992
200 Ga0114129_10025629
201 Ga0114129_10591585
202 Ga0105028_101009
203 Ga0157369_10321257
204 Ga0206353_10559063
205 Ga0206353_10909384
206 Ga0207647_10004674
207 Ga0207705_10032969
208 Ga0207707_10105988
209 Ga0207652_10130856
210 Ga0207652_10437814
211 Ga0207650_10313235
212 Ga0207650_10321706
213 Ga0207674_10222312
214 Ga0307408_100585042
215 Ga0307413_10242416
216 Ga0307410_10029792
217 Ga0307406_10067360
218 Ga0307409_100160805
219 Ga0307409_100381604
220 Ga0307416_100180284
221 Ga0307416_100312499
222 Ga0307416_100822640
223 Ga0307416_100984350
224 Ga0307414_10134523
225 Ga0307414_10245917
226 Ga0307411_10446646
227 Ga0307415_100128761
228 Ga0307415_100291707
229 Ga0307415_100375254
230 Ga0307415_100376511
231 Ga0395900_0012422
232 Ga0395900_0061264
233 Ga0395898_0123957
234 Ga0439436_0067793
235 Ga0439439_0014151
236 Ga0439447_045623
237 Ga0439466_0030833
238 Ga0439431_0098133
239 Ga0439433_0034123
240 Ga0439442_013986
241 Ga0439432_000702
242 Ga0439449_0081869
243 Ga0439457_035272
244 Ga0439462_0004462
245 Ga0450919_003489
246 Ga0450920_000295
247 Ga0450920_000764
248 Ga0450920_020941
249 Ga0439446_0021367
250 Ga0450908_001868
251 Ga0450909_001198
252 Ga0439434_0001070
253 Ga0466969_0072505
254 Ga0466965_0061872
255 Ga0466965_0161601
256 Ga0466965_0172557
257 Ga0466965_0311021
258 Ga0466966_0027095
259 Ga0466966_0127135
260 Ga0466966_0387215
261 Ga0466963_0222244
262 Ga0466963_0242325
263 Ga0466964_0161136
264 Ga0466971_0143654
265 Ga0466970_0072025
266 Ga0466957_0068416
267 Ga0466960_0132079
268 Ga0466960_0158120
269 Ga0466960_0215472
270 Ga0466959_0141373
271 Ga0466959_0284599
272 Ga0466959_0367261
273 Ga0466958_0390520
274 Ga0466967_0010624
275 Ga0466967_0078588
276 Ga0466967_0091872
277 Ga0466967_0264776
278 Ga0466967_0548834
279 Ga0495656_0033388
280 Ga0496102_0065939
281 Ga0496109_0585687
282 Ga0496114_0017319
283 Ga0496114_0303328
284 Ga0501031_0037587
285 Ga0501031_0164249
286 Ga0501032_0084001
287 Ga0501034_0008322
288 Ga0501034_0023529
289 Ga0501034_0111847
290 Ga0501036_0012963
291 Ga0501036_0037112
292 Ga0501036_0265904
293 Ga0501037_0061094
294 Ga0501038_0003134
295 Ga0501038_0098027
296 Ga0501038_0282878
297 Ga0501040_0004110
298 Ga0501040_0060965
299 Ga0501040_0090137
300 Ga0501041_0007420
301 Ga0501041_0008380
302 Ga0501042_0003228
303 Ga0501042_0029819
304 Ga0501043_0007196
305 Ga0501043_0091380
306 Ga0501046_0044396
307 Ga0501046_0231641
308 Ga0501047_0007227
309 Ga0501047_0098651
310 Ga0501048_0001237
311 Ga0501048_0135907
312 Ga0501068_0093621
313 Ga0501068_0229994
314 Ga0501069_0003623
315 Ga0501069_0029311
316 Ga0501070_0052294
317 Ga0501070_0077424
318 Ga0501070_0376382
319 Ga0501071_0124857
320 Ga0501072_0043339
321 Ga0501073_0066479
322 Ga0501073_0070785
323 Ga0501074_0001381
324 Ga0501075_0007393
325 Ga0501075_0070923
326 Ga0501075_0164592
327 Ga0501076_0002225
328 Ga0501076_0024984
329 Ga0501076_0282946
330 Ga0501076_0328139
331 Ga0501077_0001325
332 Ga0501077_0125844
333 Ga0501079_0032950
334 Ga0501079_0232857
335 Ga0501080_0000490
336 Ga0501080_0051017
337 Ga0501081_0006635
338 Ga0501081_0031332
339 Ga0501083_0033818
340 Ga0501083_0035815
341 Ga0501035_0061028
342 Ga0501035_0485619
343 Ga0501044_0338455
344 Ga0501045_0046900
345 nmdc:mga05p37_189615_c1
346 nmdc:mga05p37_36024_c1
347 nmdc:mga09592_94961_c1
348 nmdc:mga0qj67_252570_c1
349 Ga0501084_0028371
350 Ga0501084_0086589
351 Ga0501082_0007910
352 Ga0501082_0105751
353 Ga0501082_0199670
354 Ga0501082_0239321
355 Ga0501082_0391677
356 Ga0466962_0042879
357 Ga0466962_0094913
358 Ga0530510_0183208
359 Ga0530510_0504632
360 2587864070
361 2808901229
362 2816424950

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

18

69

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f72-assembly3.cif.gz_E crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant 0.901 15 73
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.8975 15 96
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8765 29 96
3f6v-assembly1.cif.gz_A-2 crystal structure of possible transcriptional regulator for arsenical resistance 0.8742 20 98
2oqg-assembly1.cif.gz_D arsr-like transcriptional regulator from rhodococcus sp. rha1 0.8707 15 96
ID Description Score Start End Superfamily
af_O06195_1_80_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9642 26 104 1.10.10.10
af_O06195_1_80_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9411 26 104 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9392 24 96 1.10.10.10
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9174 26 73 1.10.10.10
af_B4FTK6_47_112_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.89 26 98 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W0JPZ8-F1-model_v4 Transcriptional regulator 0.9718 164 236
AF-A0A239BX47-F1-model_v4 Transcriptional regulator 0.9678 163 237
AF-A0A4R5BHY6-F1-model_v4 Transcriptional regulator 0.9639 163 237
AF-A0A841D525-F1-model_v4 Putative ArsR family transcriptional regulator 0.9603 14 237
AF-A0A5C6WNQ9-F1-model_v4 deleted 0.953 166 237

Map