F276695

General Info

Members Datasets Scaffolds Average Seq Length
181 133 174 252

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10048804|Ga0070658_100488044
Length 261
Sequence MRLTVLGCSGSGPGPTSPASGYLVRAGDVQLTLDLGNGTFGALQRHLDPWALSAVAFSHLHPDHCSDFASLAVHRRYHPRPAYDPSARPLPVLAPAEAPTRFAAAYATCAAERAETDMTDIFTFHPFSDGGRVEVAGIVVQTAAVDHPCEAYAVRVEHGGRSLAYSGDTGPCAGLVEAARGADVLLCEATWPHVTEWWDEPPTGIHLSGRQAGEHAAAAGVGRLLITHVPAWFDAQELLAEAKEAFGGPVELVAPDATYEV

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
3 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
4 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
5 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
6 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
103 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
106 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
118 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
119 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
120 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
121 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
133 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.13
Metatranscriptomes 0
Isolates 3.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.73
Rhizosphere 84.53
Stem 0
Stem Tuber 0
Unclassified 7.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10048804 3300005327 Bacteria 3428
2 Ga0070658_10054535 3300005327 Bacteria 3246
3 Ga0070683_100073123 3300005329 Bacteria 3201
4 Ga0068869_100031137 3300005334 Bacteria 3752
5 Ga0070682_100049564 3300005337 Bacteria 2618
6 Ga0068868_100116232 3300005338 Bacteria 2178
7 Ga0068868_100560463 3300005338 Bacteria 1008
8 Ga0070660_100042913 3300005339 Bacteria 3454
9 Ga0070660_100189308 3300005339 Bacteria 1666
10 Ga0070661_100082156 3300005344 Bacteria 2379
11 Ga0070668_100193016 3300005347 Bacteria 1669
12 Ga0070673_100148592 3300005364 Bacteria 1983
13 Ga0070673_100416175 3300005364 Bacteria 1204
14 Ga0070659_100333255 3300005366 Bacteria 1270
15 Ga0070667_100042542 3300005367 Bacteria 3812
16 Ga0070667_100369779 3300005367 Bacteria 1301
17 Ga0070714_100327496 3300005435 Bacteria 1434
18 Ga0070714_100682957 3300005435 Bacteria 990
19 Ga0070713_100207645 3300005436 Bacteria 1772
20 Ga0070662_100094938 3300005457 Bacteria 2246
21 Ga0070679_100056058 3300005530 Bacteria 3926
22 Ga0070684_100232712 3300005535 Bacteria 1682
23 Ga0070665_100040992 3300005548 Bacteria 4654
24 Ga0070665_100375682 3300005548 Bacteria 1428
25 Ga0070665_100506145 3300005548 Bacteria 1219
26 Ga0068857_100235435 3300005577 Bacteria 1675
27 Ga0070702_100021401 3300005615 Bacteria 3402
28 Ga0068852_100290004 3300005616 Bacteria 1580
29 Ga0068863_100039599 3300005841 Bacteria 4483
30 Ga0068863_100094471 3300005841 Bacteria 2838
31 Ga0068860_100009945 3300005843 Bacteria 9426
32 Ga0068860_100273063 3300005843 Bacteria 1650
33 Ga0070717_10254539 3300006028 Bacteria 1552
34 Ga0068871_100188687 3300006358 Bacteria 1775
35 Ga0075436_100305568 3300006914 Bacteria 1141
36 Ga0105251_10128648 3300009011 Bacteria 1148
37 Ga0111539_10151352 3300009094 Bacteria 2716
38 Ga0111539_10947215 3300009094 Bacteria 1001
39 Ga0105245_10219350 3300009098 Bacteria 1834
40 Ga0105245_10233445 3300009098 Bacteria 1780
41 Ga0105241_10239126 3300009174 Bacteria 1534
42 Ga0105242_10094762 3300009176 Bacteria 2519
43 Ga0105248_10120176 3300009177 Bacteria 2964
44 Ga0105237_10462232 3300009545 Bacteria 1275
45 Ga0105238_10233105 3300009551 Bacteria 1817
46 Ga0105249_10662602 3300009553 Bacteria 1102
47 Ga0105239_11063685 3300010375 Bacteria 931
48 Ga0163162_10079206 3300013306 Bacteria 3352
49 Ga0157372_10098924 3300013307 Bacteria 3328
50 Ga0163163_10917915 3300014325 Bacteria 939
51 Ga0157377_10294731 3300014745 Bacteria 1068
52 Ga0157379_10008041 3300014968 Bacteria 9155
53 Ga0157379_10763018 3300014968 Bacteria 911
54 Ga0207656_10021388 3300025321 Bacteria 2584
55 Ga0207688_10007937 3300025901 Bacteria 5775
56 Ga0207645_10005165 3300025907 Bacteria 9541
57 Ga0207643_10004623 3300025908 Bacteria 7394
58 Ga0207705_10127370 3300025909 Bacteria 1893
59 Ga0207654_10054165 3300025911 Bacteria 2318
60 Ga0207671_10101871 3300025914 Bacteria 2176
61 Ga0207662_10014909 3300025918 Bacteria 4365
62 Ga0207662_10075309 3300025918 Bacteria 2050
63 Ga0207657_10020456 3300025919 Bacteria 6253
64 Ga0207652_10132726 3300025921 Bacteria 2222
65 Ga0207687_10043953 3300025927 Bacteria 3080
66 Ga0207700_10284927 3300025928 Bacteria 1422
67 Ga0207664_10295109 3300025929 Bacteria 1425
68 Ga0207706_10025426 3300025933 Bacteria 5305
69 Ga0207709_10278606 3300025935 Bacteria 1234
70 Ga0207691_10099219 3300025940 Bacteria 2601
71 Ga0207689_10062874 3300025942 Bacteria 3053
72 Ga0207689_10389129 3300025942 Bacteria 1161
73 Ga0207661_10509624 3300025944 Bacteria 1100
74 Ga0207667_10373368 3300025949 Bacteria 1453
75 Ga0207668_10067407 3300025972 Bacteria 2541
76 Ga0207668_10100548 3300025972 Bacteria 2148
77 Ga0207668_10703573 3300025972 Bacteria 888
78 Ga0207640_10195524 3300025981 Bacteria 1528
79 Ga0207677_10302834 3300026023 Bacteria 1321
80 Ga0207703_10114472 3300026035 Bacteria 2306
81 Ga0207678_10035308 3300026067 Bacteria 4353
82 Ga0207708_10020038 3300026075 Bacteria 5043
83 Ga0207702_10161845 3300026078 Bacteria 2044
84 Ga0207641_10018165 3300026088 Bacteria 5763
85 Ga0207648_10105891 3300026089 Bacteria 2467
86 Ga0207674_10060935 3300026116 Bacteria 3814
87 Ga0207675_100028145 3300026118 Bacteria 5233
88 Ga0268266_10008851 3300028379 Bacteria 8914
89 Ga0268266_10464537 3300028379 Bacteria 1204
90 Ga0268265_10067937 3300028380 Bacteria 2761
91 Ga0268264_10051554 3300028381 Bacteria 3429
92 Ga0307513_10009865 3300031456 Bacteria 12053
93 Ga0307409_100627389 3300031995 Bacteria 1066
94 Ga0307409_100798694 3300031995 Bacteria 951
95 Ga0307416_100453826 3300032002 Bacteria 1335
96 Ga0307416_100552799 3300032002 Bacteria 1225
97 Ga0373937_0492153 3300036401 Bacteria 1165
98 Ga0395900_0017180 3300037418 Bacteria 7385
99 Ga0395900_0027675 3300037418 Bacteria 5807
100 Ga0395898_0171198 3300037466 Bacteria 2076
101 Ga0395898_0546484 3300037466 Bacteria 1100
102 Ga0395905_0485352 3300037471 Bacteria 1135
103 Ga0395901_0012923 3300038443 Bacteria 8470
104 Ga0466969_0138732 3300044656 Bacteria 1124
105 Ga0466972_0012929 3300044658 Bacteria 4193
106 Ga0466965_0022858 3300044683 Bacteria 3016
107 Ga0466965_0099981 3300044683 Bacteria 1482
108 Ga0466966_0279179 3300044684 Bacteria 1005
109 Ga0466961_0098003 3300044693 Bacteria 1848
110 Ga0466961_0120427 3300044693 Bacteria 1648
111 Ga0466961_0136741 3300044693 Bacteria 1535
112 Ga0466963_0024588 3300044694 Bacteria 3834
113 Ga0466963_0038180 3300044694 Bacteria 3139
114 Ga0466963_0187050 3300044694 Bacteria 1447
115 Ga0466963_0233527 3300044694 Bacteria 1289
116 Ga0466964_0018780 3300044706 Bacteria 2655
117 Ga0466968_0027184 3300044735 Bacteria 2354
118 Ga0466970_0002462 3300044765 Bacteria 8955
119 Ga0466970_0038390 3300044765 Bacteria 2540
120 Ga0466970_0089574 3300044765 Bacteria 1669
121 Ga0466957_0122472 3300044842 Bacteria 1659
122 Ga0466960_0000588 3300044901 Bacteria 12592
123 Ga0466960_0031507 3300044901 Bacteria 2448
124 Ga0466960_0038045 3300044901 Bacteria 2260
125 Ga0466960_0047378 3300044901 Bacteria 2061
126 Ga0466960_0052093 3300044901 Bacteria 1979
127 Ga0466960_0263140 3300044901 Bacteria 962
128 Ga0466959_0081944 3300045049 Bacteria 2325
129 Ga0466959_0260036 3300045049 Bacteria 1195
130 Ga0466959_0380516 3300045049 Bacteria 961
131 Ga0466958_0166428 3300045836 Bacteria 1395
132 Ga0466967_0072615 3300045976 Bacteria 3084
133 Ga0466967_0093826 3300045976 Bacteria 2732
134 Ga0466967_0180814 3300045976 Bacteria 1989
135 Ga0466967_0203606 3300045976 Bacteria 1875
136 Ga0466967_0475898 3300045976 Bacteria 1223
137 Ga0466967_0829870 3300045976 Bacteria 918
138 Ga0495650_0036999 3300046471 Bacteria 2129
139 Ga0495588_0028967 3300046674 Bacteria 2775
140 Ga0495604_0003655 3300047317 Bacteria 12254
141 Ga0495687_144226 3300047443 Bacteria 823
142 Ga0495687_195355 3300047443 Bacteria 647
143 Ga0495675_0022361 3300047444 Bacteria 4030
144 Ga0496100_0003406 3300048903 Bacteria 8284
145 Ga0496101_0098153 3300048904 Bacteria 2189
146 Ga0496101_0144239 3300048904 Bacteria 1817
147 Ga0496102_0000383 3300048905 Bacteria 52390
148 Ga0496102_0538946 3300048905 Bacteria 1090
149 Ga0496103_0000019 3300048906 Bacteria 234311
150 Ga0496104_0152613 3300048907 Bacteria 2217
151 Ga0496105_0257448 3300048908 Bacteria 1412
152 Ga0496108_0244937 3300048911 Bacteria 1559
153 Ga0496108_0256330 3300048911 Bacteria 1522
154 Ga0496110_0043946 3300048913 Bacteria 3901
155 Ga0496111_0090880 3300048914 Bacteria 2237
156 Ga0496111_0265532 3300048914 Bacteria 1273
157 Ga0496114_0317107 3300048917 Bacteria 1377
158 Ga0496116_0000269 3300048919 Bacteria 90518
159 Ga0496117_0000101 3300048920 Bacteria 191796
160 Ga0496118_0002407 3300048921 Bacteria 25247
161 Ga0496119_0156792 3300048922 Bacteria 1214
162 Ga0496120_0016782 3300048923 Bacteria 4772
163 Ga0496121_0077647 3300048924 Bacteria 2643
164 Ga0496124_0274552 3300048927 Bacteria 1232
165 Ga0496125_0061086 3300048928 Bacteria 3024
166 Ga0496126_0002374 3300048929 Bacteria 25630
167 Ga0501033_0027697 3300049570 Bacteria 4260
168 Ga0501036_0546389 3300049572 Bacteria 963
169 Ga0501048_0197545 3300049582 Bacteria 1426
170 Ga0501072_0163199 3300049588 Bacteria 1778
171 nmdc:mga0qj67_51387_c1 3300050509 Bacteria 3259
172 nmdc:mga08x19_272110_c1 3300050514 Bacteria 1172
173 Ga0466962_0082064 3300061719 Bacteria 1542
174 Ga0466962_0114467 3300061719 Bacteria 1299

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044735 Ga0466968_0027184 Ga0466968_0027184_20_571 183
2 3300047443 Ga0495687_144226 Ga0495687_144226_261_812 183
3 3300047443 Ga0495687_195355 Ga0495687_195355_12_563 183
4 3300044683 Ga0466965_0099981 Ga0466965_0099981_812_1462 216
5 3300037418 Ga0395900_0017180 Ga0395900_0017180_1907_2578 223
6 3300037466 Ga0395898_0546484 Ga0395898_0546484_372_1046 224
7 3300048923 Ga0496120_0016782 Ga0496120_0016782_3920_4636 232
8 3300050514 nmdc:mga08x19_272110_c1 nmdc:mga08x19_272110_c1_229_936 234
9 3300046471 Ga0495650_0036999 Ga0495650_0036999_97_870 235
10 3300048917 Ga0496114_0317107 Ga0496114_0317107_645_1361 238
11 iso_pu_bacteria 2622736605 2623499561 238
12 3300005327 Ga0070658_10054535 Ga0070658_100545352 242
13 3300025909 Ga0207705_10127370 Ga0207705_101273702 242
14 3300031995 Ga0307409_100798694 Ga0307409_1007986941 242
15 3300032002 Ga0307416_100453826 Ga0307416_1004538261 242
16 iso_pu_bacteria 2837268691 2837272254 243
17 3300009176 Ga0105242_10094762 Ga0105242_100947623 245
18 3300005329 Ga0070683_100073123 Ga0070683_1000731232 246
19 3300005339 Ga0070660_100189308 Ga0070660_1001893082 246
20 3300005435 Ga0070714_100682957 Ga0070714_1006829571 246
21 3300005530 Ga0070679_100056058 Ga0070679_1000560582 246
22 3300005535 Ga0070684_100232712 Ga0070684_1002327122 246
23 3300025921 Ga0207652_10132726 Ga0207652_101327262 246
24 3300037466 Ga0395898_0171198 Ga0395898_0171198_126_866 246
25 3300037471 Ga0395905_0485352 Ga0395905_0485352_272_1012 246
26 3300038443 Ga0395901_0012923 Ga0395901_0012923_2236_2976 246
27 3300044684 Ga0466966_0279179 Ga0466966_0279179_58_798 246
28 3300044693 Ga0466961_0098003 Ga0466961_0098003_1024_1764 246
29 3300044693 Ga0466961_0120427 Ga0466961_0120427_120_860 246
30 3300044693 Ga0466961_0136741 Ga0466961_0136741_662_1402 246
31 3300044694 Ga0466963_0024588 Ga0466963_0024588_1182_1922 246
32 3300044694 Ga0466963_0038180 Ga0466963_0038180_1229_1969 246
33 3300044694 Ga0466963_0233527 Ga0466963_0233527_266_1006 246
34 3300044765 Ga0466970_0038390 Ga0466970_0038390_1458_2198 246
35 3300044765 Ga0466970_0089574 Ga0466970_0089574_779_1519 246
36 3300044901 Ga0466960_0031507 Ga0466960_0031507_310_1050 246
37 3300044901 Ga0466960_0038045 Ga0466960_0038045_761_1501 246
38 3300044901 Ga0466960_0047378 Ga0466960_0047378_1136_1876 246
39 3300044901 Ga0466960_0052093 Ga0466960_0052093_619_1359 246
40 3300044901 Ga0466960_0263140 Ga0466960_0263140_104_844 246
41 3300045049 Ga0466959_0081944 Ga0466959_0081944_1200_1940 246
42 3300045049 Ga0466959_0380516 Ga0466959_0380516_128_868 246
43 3300045976 Ga0466967_0072615 Ga0466967_0072615_1347_2087 246
44 3300045976 Ga0466967_0203606 Ga0466967_0203606_120_860 246
45 3300061719 Ga0466962_0082064 Ga0466962_0082064_621_1361 246
46 3300061719 Ga0466962_0114467 Ga0466962_0114467_275_1015 246
47 3300005347 Ga0070668_100193016 Ga0070668_1001930162 247
48 3300005841 Ga0068863_100039599 Ga0068863_1000395994 247
49 3300014968 Ga0157379_10008041 Ga0157379_1000804110 247
50 3300025972 Ga0207668_10067407 Ga0207668_100674073 247
51 3300026088 Ga0207641_10018165 Ga0207641_100181659 247
52 3300032002 Ga0307416_100552799 Ga0307416_1005527992 247
53 3300044694 Ga0466963_0187050 Ga0466963_0187050_34_777 247
54 3300048903 Ga0496100_0003406 Ga0496100_0003406_7386_8147 247
55 3300048904 Ga0496101_0144239 Ga0496101_0144239_691_1452 247
56 3300048905 Ga0496102_0000383 Ga0496102_0000383_31492_32253 247
57 3300048906 Ga0496103_0000019 Ga0496103_0000019_95327_96088 247
58 3300048908 Ga0496105_0257448 Ga0496105_0257448_103_864 247
59 3300048911 Ga0496108_0244937 Ga0496108_0244937_732_1493 247
60 3300048914 Ga0496111_0265532 Ga0496111_0265532_60_821 247
61 3300048919 Ga0496116_0000269 Ga0496116_0000269_4322_5083 247
62 3300048920 Ga0496117_0000101 Ga0496117_0000101_95728_96489 247
63 3300048921 Ga0496118_0002407 Ga0496118_0002407_20162_20923 247
64 3300048922 Ga0496119_0156792 Ga0496119_0156792_97_858 247
65 3300048924 Ga0496121_0077647 Ga0496121_0077647_1138_1899 247
66 3300048927 Ga0496124_0274552 Ga0496124_0274552_357_1118 247
67 3300048928 Ga0496125_0061086 Ga0496125_0061086_696_1457 247
68 3300048929 Ga0496126_0002374 Ga0496126_0002374_4316_5077 247
69 3300049572 Ga0501036_0546389 Ga0501036_0546389_196_939 247
70 3300049582 Ga0501048_0197545 Ga0501048_0197545_39_782 247
71 3300009011 Ga0105251_10128648 Ga0105251_101286481 248
72 3300046674 Ga0495588_0028967 Ga0495588_0028967_1108_1854 248
73 3300047317 Ga0495604_0003655 Ga0495604_0003655_10456_11205 248
74 3300047444 Ga0495675_0022361 Ga0495675_0022361_1217_1966 248
75 3300045976 Ga0466967_0093826 Ga0466967_0093826_485_1270 249
76 iso_pu_bacteria 2915358134 2915360566 249
77 3300014745 Ga0157377_10294731 Ga0157377_102947311 250
78 3300036401 Ga0373937_0492153 Ga0373937_0492153_313_1098 250
79 3300044656 Ga0466969_0138732 Ga0466969_0138732_348_1100 250
80 3300049570 Ga0501033_0027697 Ga0501033_0027697_2159_2941 250
81 3300044658 Ga0466972_0012929 Ga0466972_0012929_2518_3291 251
82 3300044683 Ga0466965_0022858 Ga0466965_0022858_335_1108 251
83 3300044765 Ga0466970_0002462 Ga0466970_0002462_4582_5355 251
84 3300044901 Ga0466960_0000588 Ga0466960_0000588_7287_8060 251
85 3300045049 Ga0466959_0260036 Ga0466959_0260036_40_813 251
86 3300005548 Ga0070665_100040992 Ga0070665_1000409925 253
87 3300005841 Ga0068863_100094471 Ga0068863_1000944714 253
88 3300005843 Ga0068860_100009945 Ga0068860_1000099453 253
89 3300025972 Ga0207668_10100548 Ga0207668_101005483 253
90 3300028379 Ga0268266_10008851 Ga0268266_1000885112 253
91 3300028381 Ga0268264_10051554 Ga0268264_100515544 253
92 3300045976 Ga0466967_0829870 Ga0466967_0829870_103_885 253
93 iso_pu_bacteria 8054472261 8054478818 253
94 3300044842 Ga0466957_0122472 Ga0466957_0122472_131_916 254
95 3300045976 Ga0466967_0475898 Ga0466967_0475898_106_891 254
96 3300037418 Ga0395900_0027675 Ga0395900_0027675_1968_2753 256
97 iso_pu_bacteria 2558860112 2558909010 256
98 3300005338 Ga0068868_100560463 Ga0068868_1005604632 257
99 3300005364 Ga0070673_100416175 Ga0070673_1004161752 257
100 3300005548 Ga0070665_100506145 Ga0070665_1005061452 257
101 3300005616 Ga0068852_100290004 Ga0068852_1002900042 257
102 3300006914 Ga0075436_100305568 Ga0075436_1003055682 257
103 3300009094 Ga0111539_10151352 Ga0111539_101513522 257
104 3300009098 Ga0105245_10233445 Ga0105245_102334452 257
105 3300014968 Ga0157379_10763018 Ga0157379_107630181 257
106 3300025918 Ga0207662_10075309 Ga0207662_100753092 257
107 3300025935 Ga0207709_10278606 Ga0207709_102786062 257
108 3300025942 Ga0207689_10389129 Ga0207689_103891292 257
109 3300025944 Ga0207661_10509624 Ga0207661_105096242 257
110 3300025981 Ga0207640_10195524 Ga0207640_101955243 257
111 3300026023 Ga0207677_10302834 Ga0207677_103028342 257
112 3300026035 Ga0207703_10114472 Ga0207703_101144723 257
113 3300048911 Ga0496108_0256330 Ga0496108_0256330_251_1030 257
114 3300048914 Ga0496111_0090880 Ga0496111_0090880_658_1437 257
115 3300050509 nmdc:mga0qj67_51387_c1 nmdc:mga0qj67_51387_c1_1423_2199 257
116 iso_pu_bacteria 2816332139 2816511266 257
117 iso_pu_bacteria 2870782633 2870788605 257
118 3300005367 Ga0070667_100042542 Ga0070667_1000425422 259
119 3300005327 Ga0070658_10048804 Ga0070658_100488044 261
120 3300005334 Ga0068869_100031137 Ga0068869_1000311374 261
121 3300005337 Ga0070682_100049564 Ga0070682_1000495642 261
122 3300005338 Ga0068868_100116232 Ga0068868_1001162322 261
123 3300005339 Ga0070660_100042913 Ga0070660_1000429133 261
124 3300005344 Ga0070661_100082156 Ga0070661_1000821561 261
125 3300005364 Ga0070673_100148592 Ga0070673_1001485923 261
126 3300005366 Ga0070659_100333255 Ga0070659_1003332551 261
127 3300005367 Ga0070667_100369779 Ga0070667_1003697792 261
128 3300005435 Ga0070714_100327496 Ga0070714_1003274962 261
129 3300005436 Ga0070713_100207645 Ga0070713_1002076452 261
130 3300005457 Ga0070662_100094938 Ga0070662_1000949382 261
131 3300005548 Ga0070665_100375682 Ga0070665_1003756823 261
132 3300005577 Ga0068857_100235435 Ga0068857_1002354352 261
133 3300005615 Ga0070702_100021401 Ga0070702_1000214015 261
134 3300005843 Ga0068860_100273063 Ga0068860_1002730632 261
135 3300006028 Ga0070717_10254539 Ga0070717_102545392 261
136 3300006358 Ga0068871_100188687 Ga0068871_1001886872 261
137 3300009094 Ga0111539_10947215 Ga0111539_109472151 261
138 3300009098 Ga0105245_10219350 Ga0105245_102193503 261
139 3300009174 Ga0105241_10239126 Ga0105241_102391263 261
140 3300009177 Ga0105248_10120176 Ga0105248_101201762 261
141 3300009545 Ga0105237_10462232 Ga0105237_104622322 261
142 3300009551 Ga0105238_10233105 Ga0105238_102331052 261
143 3300009553 Ga0105249_10662602 Ga0105249_106626021 261
144 3300010375 Ga0105239_11063685 Ga0105239_110636851 261
145 3300013306 Ga0163162_10079206 Ga0163162_100792064 261
146 3300013307 Ga0157372_10098924 Ga0157372_100989243 261
147 3300014325 Ga0163163_10917915 Ga0163163_109179151 261
148 3300025321 Ga0207656_10021388 Ga0207656_100213882 261
149 3300025901 Ga0207688_10007937 Ga0207688_100079374 261
150 3300025907 Ga0207645_10005165 Ga0207645_100051656 261
151 3300025908 Ga0207643_10004623 Ga0207643_100046234 261
152 3300025911 Ga0207654_10054165 Ga0207654_100541652 261
153 3300025914 Ga0207671_10101871 Ga0207671_101018714 261
154 3300025918 Ga0207662_10014909 Ga0207662_100149094 261
155 3300025919 Ga0207657_10020456 Ga0207657_100204565 261
156 3300025927 Ga0207687_10043953 Ga0207687_100439534 261
157 3300025928 Ga0207700_10284927 Ga0207700_102849272 261
158 3300025929 Ga0207664_10295109 Ga0207664_102951092 261
159 3300025933 Ga0207706_10025426 Ga0207706_100254266 261
160 3300025940 Ga0207691_10099219 Ga0207691_100992191 261
161 3300025942 Ga0207689_10062874 Ga0207689_100628744 261
162 3300025949 Ga0207667_10373368 Ga0207667_103733682 261
163 3300025972 Ga0207668_10703573 Ga0207668_107035731 261
164 3300026067 Ga0207678_10035308 Ga0207678_100353085 261
165 3300026075 Ga0207708_10020038 Ga0207708_100200383 261
166 3300026078 Ga0207702_10161845 Ga0207702_101618453 261
167 3300026089 Ga0207648_10105891 Ga0207648_101058912 261
168 3300026116 Ga0207674_10060935 Ga0207674_100609354 261
169 3300026118 Ga0207675_100028145 Ga0207675_1000281455 261
170 3300028379 Ga0268266_10464537 Ga0268266_104645372 261
171 3300028380 Ga0268265_10067937 Ga0268265_100679373 261
172 3300031456 Ga0307513_10009865 Ga0307513_1000986510 261
173 3300031995 Ga0307409_100627389 Ga0307409_1006273892 261
174 3300044706 Ga0466964_0018780 Ga0466964_0018780_980_1765 261
175 3300045836 Ga0466958_0166428 Ga0466958_0166428_281_1066 261
176 3300045976 Ga0466967_0180814 Ga0466967_0180814_937_1722 261
177 3300048904 Ga0496101_0098153 Ga0496101_0098153_640_1425 261
178 3300048905 Ga0496102_0538946 Ga0496102_0538946_98_883 261
179 3300048907 Ga0496104_0152613 Ga0496104_0152613_463_1248 261
180 3300048913 Ga0496110_0043946 Ga0496110_0043946_1796_2581 261
181 3300049588 Ga0501072_0163199 Ga0501072_0163199_182_976 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

14

255

0.79

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

33

229

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kns-assembly2.cif.gz_B-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.93 2 261
6kns-assembly4.cif.gz_D-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.9277 2 260
6kns-assembly3.cif.gz_C-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.9237 2 261
6kns-assembly2.cif.gz_B-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.9153 2 261
6kns-assembly4.cif.gz_D-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.913 2 260
ID Description Score Start End Superfamily
af_P9WGC1_17_267_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.951 2 259 3.60.15.10
af_P9WGC1_17_267_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9399 2 259 3.60.15.10
af_Q4DTW2_23_113_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8999 125 172 3.60.15.10
af_Q4DTW2_3_265_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8999 125 172 3.60.15.10
1zkpC00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8825 3 261 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A292YYI1-F1-model_v4 Metal-dependent hydrolase of the beta-lactamase superfamily III 0.9914 1 261 GO:0042781
AF-A0A511DDS0-F1-model_v4 MBL fold metallo-hydrolase 0.9913 1 261 GO:0042781
AF-A0A7W1Q216-F1-model_v4 MBL fold metallo-hydrolase 0.9882 1 92 GO:0042781
AF-A0A7V9BWD8-F1-model_v4 MBL fold metallo-hydrolase 0.9812 60 261 GO:0042781
AF-A0A143YIM9-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9778 1 76 GO:0042781

Feature Viewer

pLDDT pTM Quality
94.8 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map