F276067

General Info

Members Datasets Scaffolds Average Seq Length
180 106 360 189

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0006117|Ga0453684_0006117_5347_5949
Length 181
Sequence MLALRILVAITGASGAIYAQRLLDNLPSKDHELHVVLSKYAPMVISEELPGGLRVPPQTTTHNLRSMNAPFASGSNAPDAMVVIPCSMGTLGRIAHGASDDVRETPLNLVHVRNFELLILAGATILPANPSFYTRPRTIEQLADTVVARVLDHLGVRQALVPRWGDPEAAGPAGSNPGERD

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
47 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
48 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
49 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
50 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
51 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
54 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
55 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
56 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
57 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
58 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
68 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
69 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
70 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
71 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
72 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
79 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
89 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
92 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
95 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
96 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
97 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.11
Rhizosphere 98.33
Stem 0
Stem Tuber 0
Unclassified 32.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0006117 3300044712 Bacteria 23181
2 Ga0070690_100016692 3300005330 Bacteria 4404
3 Ga0070689_100030666 3300005340 Bacteria 4082
4 Ga0070689_100102799 3300005340 Unclassified 2264
5 Ga0070689_100226482 3300005340 Bacteria 1536
6 Ga0070689_100379513 3300005340 Bacteria 1191
7 Ga0070687_100351424 3300005343 Bacteria 952
8 Ga0070675_101155541 3300005354 Unclassified 712
9 Ga0070688_100180607 3300005365 Bacteria 1463
10 Ga0070688_100270086 3300005365 Bacteria 1218
11 Ga0070713_100387608 3300005436 Unclassified 1303
12 Ga0070711_100221387 3300005439 Bacteria 1471
13 Ga0070711_100460547 3300005439 Unclassified 1042
14 Ga0070700_100670067 3300005441 Bacteria 821
15 Ga0070681_10004782 3300005458 Bacteria 12978
16 Ga0070681_10251398 3300005458 Unclassified 1680
17 Ga0070681_10276722 3300005458 Unclassified 1590
18 Ga0070685_10585382 3300005466 Unclassified 801
19 Ga0070679_100249460 3300005530 Bacteria 1732
20 Ga0070679_100282028 3300005530 Bacteria 1614
21 Ga0068853_100109108 3300005539 Bacteria 2456
22 Ga0070686_101096712 3300005544 Unclassified 657
23 Ga0068855_100037597 3300005563 Bacteria 5756
24 Ga0068855_100100016 3300005563 Bacteria 3339
25 Ga0068855_100146560 3300005563 Unclassified 2687
26 Ga0068856_101356121 3300005614 Unclassified 726
27 Ga0068859_100012925 3300005617 Bacteria 8388
28 Ga0068859_100281682 3300005617 Unclassified 1755
29 Ga0068859_100564425 3300005617 Unclassified 1232
30 Ga0068859_101019380 3300005617 Bacteria 909
31 Ga0068871_100367318 3300006358 Bacteria 1276
32 Ga0075428_100004133 3300006844 Bacteria 15976
33 Ga0097620_100012925 3300006931 Bacteria 8388
34 Ga0097620_100281688 3300006931 Unclassified 1755
35 Ga0097620_100564456 3300006931 Unclassified 1232
36 Ga0097620_101019763 3300006931 Bacteria 909
37 Ga0099794_10085916 3300007265 Bacteria 1557
38 Ga0105240_10019177 3300009093 Bacteria 9144
39 Ga0105240_10050249 3300009093 Bacteria 5258
40 Ga0105240_10296294 3300009093 Bacteria 1852
41 Ga0105240_11154994 3300009093 Unclassified 822
42 Ga0111539_10009191 3300009094 Bacteria 12492
43 Ga0111539_10134499 3300009094 Unclassified 2895
44 Ga0111539_10190134 3300009094 Unclassified 2396
45 Ga0111539_11129906 3300009094 Unclassified 910
46 Ga0111539_11457750 3300009094 Bacteria 794
47 Ga0105245_10455678 3300009098 Bacteria 1288
48 Ga0114129_12498545 3300009147 Unclassified 618
49 Ga0105242_10223698 3300009176 Bacteria 1683
50 Ga0105248_10906873 3300009177 Archaea 995
51 Ga0105248_12086877 3300009177 Bacteria 644
52 Ga0157370_10049434 3300013104 Bacteria 4024
53 Ga0157374_10264308 3300013296 Bacteria 1695
54 Ga0157374_10633684 3300013296 Bacteria 1080
55 Ga0157374_11012292 3300013296 Unclassified 850
56 Ga0157378_10323915 3300013297 Bacteria 1498
57 Ga0157378_10699962 3300013297 Bacteria 1032
58 Ga0157375_10276881 3300013308 Bacteria 1840
59 Ga0163163_10268161 3300014325 Bacteria 1758
60 Ga0163163_10716626 3300014325 Bacteria 1064
61 Ga0157380_10721568 3300014326 Bacteria 1004
62 Ga0207707_10077258 3300025912 Unclassified 2906
63 Ga0207707_10093873 3300025912 Bacteria 2621
64 Ga0207707_10210970 3300025912 Unclassified 1692
65 Ga0207695_10018891 3300025913 Bacteria 7953
66 Ga0207662_10195588 3300025918 Bacteria 1306
67 Ga0207652_10264308 3300025921 Bacteria 1552
68 Ga0207652_10568206 3300025921 Unclassified 1018
69 Ga0207652_10793114 3300025921 Bacteria 841
70 Ga0207694_10042507 3300025924 Bacteria 3505
71 Ga0207659_11036556 3300025926 Unclassified 706
72 Ga0207700_10346363 3300025928 Unclassified 1293
73 Ga0207670_10693564 3300025936 Unclassified 842
74 Ga0207667_10090472 3300025949 Bacteria 3162
75 Ga0207667_10854616 3300025949 Unclassified 904
76 Ga0207677_10293925 3300026023 Viruses 1339
77 Ga0207639_11245343 3300026041 Bacteria 698
78 Ga0207702_10926625 3300026078 Bacteria 863
79 Ga0207428_10224688 3300027907 Unclassified 1406
80 Ga0265337_1001476 3300028556 Bacteria 11530
81 Ga0265337_1002738 3300028556 Bacteria 7917
82 Ga0265337_1003851 3300028556 Bacteria 6369
83 Ga0265326_10055814 3300028558 Bacteria 1117
84 Ga0265319_1012187 3300028563 Bacteria 3484
85 Ga0265334_10010971 3300028573 Unclassified 3823
86 Ga0265336_10005539 3300028666 Bacteria 4650
87 Ga0265336_10010897 3300028666 Unclassified 3102
88 Ga0265338_10000084 3300028800 Bacteria 175415
89 Ga0265338_10001039 3300028800 Bacteria 46422
90 Ga0265338_10002806 3300028800 Bacteria 25440
91 Ga0265338_10004991 3300028800 Bacteria 17550
92 Ga0265338_10006452 3300028800 Bacteria 14952
93 Ga0265338_10008841 3300028800 Bacteria 12153
94 Ga0265338_10010635 3300028800 Bacteria 10752
95 Ga0265338_10024482 3300028800 Bacteria 6166
96 Ga0265338_10028839 3300028800 Bacteria 5523
97 Ga0265338_10049460 3300028800 Bacteria 3811
98 Ga0265338_10133476 3300028800 Bacteria 1956
99 Ga0265324_10005047 3300029957 Bacteria 5787
100 Ga0265324_10025248 3300029957 Unclassified 2106
101 Ga0265332_10017250 3300031238 Bacteria 3186
102 Ga0265320_10000145 3300031240 Bacteria 59716
103 Ga0265320_10047930 3300031240 Unclassified 2087
104 Ga0265325_10017449 3300031241 Unclassified 3988
105 Ga0265329_10002342 3300031242 Bacteria 8656
106 Ga0265339_10002619 3300031249 Bacteria 12838
107 Ga0265327_10008122 3300031251 Bacteria 7900
108 Ga0265316_10061734 3300031344 Bacteria 2910
109 Ga0265316_10091036 3300031344 Bacteria 2327
110 Ga0265316_10212769 3300031344 Unclassified 1429
111 Ga0265314_10001213 3300031711 Bacteria 29629
112 Ga0307405_10147973 3300031731 Unclassified 1648
113 Ga0307406_10490683 3300031901 Unclassified 994
114 Ga0307412_10083416 3300031911 Bacteria 2216
115 Ga0307416_100584270 3300032002 Bacteria 1195
116 Ga0307411_10025999 3300032005 Unclassified 3517
117 Ga0373926_0161572 3300035083 Unclassified 855
118 Ga0373926_0184278 3300035083 Unclassified 801
119 Ga0373944_0072669 3300035089 Bacteria 1123
120 Ga0373945_0146966 3300035116 Unclassified 953
121 Ga0373943_0449794 3300035170 Unclassified 748
122 Ga0373931_0086139 3300035691 Bacteria 1743
123 Ga0373931_0286118 3300035691 Bacteria 1014
124 Ga0373935_0010540 3300035692 Bacteria 5546
125 Ga0373935_0079458 3300035692 Bacteria 2129
126 Ga0373927_0020222 3300035695 Unclassified 4365
127 Ga0373947_0001348 3300035725 Bacteria 15085
128 Ga0373947_0023673 3300035725 Bacteria 3575
129 Ga0373925_0016748 3300037068 Bacteria 5308
130 Ga0395905_0022507 3300037471 Bacteria 5961
131 Ga0395901_1617492 3300038443 Unclassified 601
132 Ga0451807_1211958 3300041486 Bacteria 2716
133 Ga0451851_0826715 3300041507 Bacteria 877
134 Ga0451577_0000911 3300042876 Bacteria 43516
135 Ga0451577_0002019 3300042876 Bacteria 25179
136 Ga0451577_0162969 3300042876 Bacteria 2008
137 Ga0451577_1186381 3300042876 Bacteria 681
138 Ga0453684_0006095 3300044712 Bacteria 23250
139 Ga0453684_0153323 3300044712 Unclassified 2735
140 Ga0453684_0479753 3300044712 Unclassified 1380
141 Ga0453684_0658506 3300044712 Bacteria 1142
142 Ga0466959_0439345 3300045049 Unclassified 885
143 Ga0451576_0054027 3300045051 Bacteria 4206
144 Ga0451576_0068643 3300045051 Bacteria 3689
145 Ga0451576_0107703 3300045051 Unclassified 2900
146 Ga0451576_0220573 3300045051 Bacteria 1980
147 Ga0451576_1482463 3300045051 Bacteria 705
148 Ga0495582_0029590 3300046473 Bacteria 3006
149 Ga0495639_0081337 3300046475 Bacteria 1509
150 Ga0495639_0105513 3300046475 Bacteria 1334
151 Ga0495618_0205060 3300046514 Bacteria 1247
152 Ga0495628_0162962 3300046516 Bacteria 1694
153 Ga0495628_0179954 3300046516 Bacteria 1600
154 Ga0495630_0000077 3300046517 Bacteria 76692
155 Ga0495630_0605446 3300046517 Unclassified 840
156 Ga0495640_0446475 3300046533 Bacteria 790
157 Ga0495586_0000044 3300046535 Bacteria 74379
158 Ga0495586_0057535 3300046535 Unclassified 2110
159 Ga0495634_0141836 3300046642 Bacteria 1525
160 Ga0495647_0025622 3300046681 Unclassified 2156
161 Ga0495658_0018962 3300046683 Bacteria 3585
162 Ga0495613_0084255 3300046689 Unclassified 2308
163 Ga0495613_0101553 3300046689 Bacteria 2077
164 Ga0495624_0032532 3300046690 Unclassified 3381
165 Ga0495674_0000586 3300047319 Bacteria 34088
166 Ga0495676_0071775 3300047321 Unclassified 2661
167 Ga0495676_0113628 3300047321 Bacteria 1982
168 Ga0495614_0101364 3300048089 Bacteria 1259
169 Ga0496115_0001538 3300048918 Bacteria 16546
170 Ga0501080_0069653 3300049742 Bacteria 3272
171 Ga0501083_0158150 3300049744 Bacteria 1483
172 Ga0501035_0032640 3300049822 Bacteria 4736
173 nmdc:mga05p37_631379_c1 3300050507 Unclassified 1203
174 nmdc:mga09592_83483_c1 3300050508 Unclassified 2723
175 nmdc:mga06r32_222054_c1 3300050510 Unclassified 1878
176 nmdc:mga06r32_225549_c1 3300050510 Bacteria 1862
177 nmdc:mga08y16_109292_c1 3300050511 Unclassified 2879
178 nmdc:mga08y16_186965_c1 3300050511 Bacteria 2149
179 nmdc:mga08y16_5226_c1 3300050511 Bacteria 13559
180 Ga0495595_0318596 3300053084 Unclassified 783
181 Ga0453684_0006117
182 Ga0070690_100016692
183 Ga0070689_100030666
184 Ga0070689_100102799
185 Ga0070689_100226482
186 Ga0070689_100379513
187 Ga0070687_100351424
188 Ga0070675_101155541
189 Ga0070688_100180607
190 Ga0070688_100270086
191 Ga0070713_100387608
192 Ga0070711_100221387
193 Ga0070711_100460547
194 Ga0070700_100670067
195 Ga0070681_10004782
196 Ga0070681_10251398
197 Ga0070681_10276722
198 Ga0070685_10585382
199 Ga0070679_100249460
200 Ga0070679_100282028
201 Ga0068853_100109108
202 Ga0070686_101096712
203 Ga0068855_100037597
204 Ga0068855_100100016
205 Ga0068855_100146560
206 Ga0068856_101356121
207 Ga0068859_100012925
208 Ga0068859_100281682
209 Ga0068859_100564425
210 Ga0068859_101019380
211 Ga0068871_100367318
212 Ga0075428_100004133
213 Ga0097620_100012925
214 Ga0097620_100281688
215 Ga0097620_100564456
216 Ga0097620_101019763
217 Ga0099794_10085916
218 Ga0105240_10019177
219 Ga0105240_10050249
220 Ga0105240_10296294
221 Ga0105240_11154994
222 Ga0111539_10009191
223 Ga0111539_10134499
224 Ga0111539_10190134
225 Ga0111539_11129906
226 Ga0111539_11457750
227 Ga0105245_10455678
228 Ga0114129_12498545
229 Ga0105242_10223698
230 Ga0105248_10906873
231 Ga0105248_12086877
232 Ga0157370_10049434
233 Ga0157374_10264308
234 Ga0157374_10633684
235 Ga0157374_11012292
236 Ga0157378_10323915
237 Ga0157378_10699962
238 Ga0157375_10276881
239 Ga0163163_10268161
240 Ga0163163_10716626
241 Ga0157380_10721568
242 Ga0207707_10077258
243 Ga0207707_10093873
244 Ga0207707_10210970
245 Ga0207695_10018891
246 Ga0207662_10195588
247 Ga0207652_10264308
248 Ga0207652_10568206
249 Ga0207652_10793114
250 Ga0207694_10042507
251 Ga0207659_11036556
252 Ga0207700_10346363
253 Ga0207670_10693564
254 Ga0207667_10090472
255 Ga0207667_10854616
256 Ga0207677_10293925
257 Ga0207639_11245343
258 Ga0207702_10926625
259 Ga0207428_10224688
260 Ga0265337_1001476
261 Ga0265337_1002738
262 Ga0265337_1003851
263 Ga0265326_10055814
264 Ga0265319_1012187
265 Ga0265334_10010971
266 Ga0265336_10005539
267 Ga0265336_10010897
268 Ga0265338_10000084
269 Ga0265338_10001039
270 Ga0265338_10002806
271 Ga0265338_10004991
272 Ga0265338_10006452
273 Ga0265338_10008841
274 Ga0265338_10010635
275 Ga0265338_10024482
276 Ga0265338_10028839
277 Ga0265338_10049460
278 Ga0265338_10133476
279 Ga0265324_10005047
280 Ga0265324_10025248
281 Ga0265332_10017250
282 Ga0265320_10000145
283 Ga0265320_10047930
284 Ga0265325_10017449
285 Ga0265329_10002342
286 Ga0265339_10002619
287 Ga0265327_10008122
288 Ga0265316_10061734
289 Ga0265316_10091036
290 Ga0265316_10212769
291 Ga0265314_10001213
292 Ga0307405_10147973
293 Ga0307406_10490683
294 Ga0307412_10083416
295 Ga0307416_100584270
296 Ga0307411_10025999
297 Ga0373926_0161572
298 Ga0373926_0184278
299 Ga0373944_0072669
300 Ga0373945_0146966
301 Ga0373943_0449794
302 Ga0373931_0086139
303 Ga0373931_0286118
304 Ga0373935_0010540
305 Ga0373935_0079458
306 Ga0373927_0020222
307 Ga0373947_0001348
308 Ga0373947_0023673
309 Ga0373925_0016748
310 Ga0395905_0022507
311 Ga0395901_1617492
312 Ga0451807_1211958
313 Ga0451851_0826715
314 Ga0451577_0000911
315 Ga0451577_0002019
316 Ga0451577_0162969
317 Ga0451577_1186381
318 Ga0453684_0006095
319 Ga0453684_0153323
320 Ga0453684_0479753
321 Ga0453684_0658506
322 Ga0466959_0439345
323 Ga0451576_0054027
324 Ga0451576_0068643
325 Ga0451576_0107703
326 Ga0451576_0220573
327 Ga0451576_1482463
328 Ga0495582_0029590
329 Ga0495639_0081337
330 Ga0495639_0105513
331 Ga0495618_0205060
332 Ga0495628_0162962
333 Ga0495628_0179954
334 Ga0495630_0000077
335 Ga0495630_0605446
336 Ga0495640_0446475
337 Ga0495586_0000044
338 Ga0495586_0057535
339 Ga0495634_0141836
340 Ga0495647_0025622
341 Ga0495658_0018962
342 Ga0495613_0084255
343 Ga0495613_0101553
344 Ga0495624_0032532
345 Ga0495674_0000586
346 Ga0495676_0071775
347 Ga0495676_0113628
348 Ga0495614_0101364
349 Ga0496115_0001538
350 Ga0501080_0069653
351 Ga0501083_0158150
352 Ga0501035_0032640
353 nmdc:mga05p37_631379_c1
354 nmdc:mga09592_83483_c1
355 nmdc:mga06r32_222054_c1
356 nmdc:mga06r32_225549_c1
357 nmdc:mga08y16_109292_c1
358 nmdc:mga08y16_186965_c1
359 nmdc:mga08y16_5226_c1
360 Ga0495595_0318596

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02441

Flavoprotein

Flavoprotein

4

154

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qlv-assembly1.cif.gz_K crystal structure of w200h ubix in complex with a geranyl-fmn n5 adduct 0.9497 3 175
4rhe-assembly1.cif.gz_B crystal structure of ubix, an aromatic acid decarboxylase from the colwellia psychrerythraea 34h 0.9487 2 180
6m8v-assembly1.cif.gz_A crystal structure of ubix-like fmn prenyltransferase mj0101 from methanocaldococcus jannaschii, fmn complex 0.9448 1 181
7km2-assembly1.cif.gz_K dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn 0.9448 3 180
7km2-assembly1.cif.gz_F dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn 0.9401 3 180
ID Description Score Start End Superfamily
4zavA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9392 3 185 3.40.50.1950
2ejbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9338 2 175 3.40.50.1950
4zavA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9245 3 185 3.40.50.1950
2ejbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9134 2 175 3.40.50.1950
1sbzC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9092 4 173 3.40.50.1950
ID Description Score Start End GO Terms
AF-A0A3D6D410-F1-model_v4 3-octaprenyl-4-hydroxybenzoate carboxy-lyase 0.988 1 177 GO:0004659
GO:0016829
AF-A0A3D6D410-F1-model_v4 3-octaprenyl-4-hydroxybenzoate carboxy-lyase 0.9825 1 177 GO:0004659
GO:0016829
AF-A0A1V6DUW4-F1-model_v4 deleted 0.9805 1 185
AF-A0A382HL77-F1-model_v4 Flavoprotein domain-containing protein 0.9776 3 185 GO:0004659
AF-A0A1V6DUW4-F1-model_v4 deleted 0.9752 1 185

Map