F276037

General Info

Members Datasets Scaffolds Average Seq Length
180 146 360 122

Family's Representative Sequence

Representative Sequence 3300042993|Ga0439440_0089882|Ga0439440_0089882_316_717
Length 133
Sequence MTMFSKFISTVVGEKGQWREYKARVRQLPASYRTAVDALERYLKYFGTGGGGTAIYEDLIDLFEQSAANGTPIREIVGEDPVEFIETFVRNYPKGQWILRERERLTNAIKRAEGEEGPAHDEATVPRAAIRVQ

Samples

Sample ID Description Type Environment
1 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
53 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
54 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
59 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
60 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
61 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
67 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
68 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
69 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
70 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
71 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
72 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
73 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
74 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
75 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
76 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
77 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
82 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
83 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
84 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
85 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
86 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
87 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
90 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
91 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
92 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
101 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
113 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
126 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
127 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
128 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
131 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
132 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
133 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
134 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
135 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
136 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
137 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
138 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
139 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
140 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
144 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
145 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
146 2895427314 Nonomuraea sp. PA05 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 0
Isolates 1.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.22
Nodule 0
Rhizoplane 10
Rhizosphere 75.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439440_0089882 3300042993 Bacteria 823
2 rootH1_10131781 3300003323 Bacteria 1175
3 JGI25407J50210_10018523 3300003373 Bacteria 1809
4 Ga0070683_101993133 3300005329 Bacteria 558
5 Ga0070666_10815290 3300005335 Bacteria 688
6 Ga0070682_100192161 3300005337 Bacteria 1434
7 Ga0070674_100057036 3300005356 Bacteria 2710
8 Ga0070710_10321518 3300005437 Bacteria 1016
9 Ga0070678_100356044 3300005456 Bacteria 1260
10 Ga0070698_100303043 3300005471 Bacteria 1528
11 Ga0068866_10099362 3300005718 Bacteria 1602
12 Ga0068861_100162654 3300005719 Bacteria 1842
13 Ga0068870_10804088 3300005840 Bacteria 657
14 Ga0081455_10065624 3300005937 Bacteria 3035
15 Ga0081538_10001165 3300005981 Bacteria 27756
16 Ga0081538_10114837 3300005981 Bacteria 1311
17 Ga0081538_10172705 3300005981 Bacteria 940
18 Ga0081540_1155349 3300005983 Bacteria 896
19 Ga0081539_10215524 3300005985 Bacteria 877
20 Ga0081539_10304165 3300005985 Bacteria 684
21 Ga0070717_10139666 3300006028 Bacteria 2089
22 Ga0070717_10432275 3300006028 Bacteria 1185
23 Ga0097621_100621282 3300006237 Bacteria 989
24 Ga0075428_100013620 3300006844 Bacteria 9056
25 Ga0075428_100464176 3300006844 Bacteria 1356
26 Ga0075430_100327815 3300006846 Bacteria 1265
27 Ga0075430_100503302 3300006846 Bacteria 1000
28 Ga0075431_100410476 3300006847 Bacteria 1354
29 Ga0075433_10001894 3300006852 Bacteria 15732
30 Ga0075434_100039806 3300006871 Bacteria 4655
31 Ga0075429_100075429 3300006880 Bacteria 2937
32 Ga0075429_100897637 3300006880 Bacteria 776
33 Ga0075435_100372485 3300007076 Bacteria 1226
34 Ga0105240_10958428 3300009093 Bacteria 917
35 Ga0111539_10222500 3300009094 Bacteria 2198
36 Ga0105245_11411996 3300009098 Bacteria 746
37 Ga0105247_11095947 3300009101 Bacteria 628
38 Ga0114129_10003457 3300009147 Bacteria 22215
39 Ga0105243_10509525 3300009148 Bacteria 1142
40 Ga0105242_10680521 3300009176 Bacteria 1004
41 Ga0105249_10554442 3300009553 Bacteria 1200
42 Ga0105239_11399050 3300010375 Bacteria 807
43 Ga0157371_10412963 3300013102 Bacteria 989
44 Ga0157378_10058701 3300013297 Bacteria 3431
45 Ga0157378_10682684 3300013297 Bacteria 1045
46 Ga0163162_10938528 3300013306 Bacteria 977
47 Ga0157372_11669417 3300013307 Bacteria 733
48 Ga0157372_12022823 3300013307 Bacteria 662
49 Ga0157372_12036875 3300013307 Bacteria 660
50 Ga0157375_10871831 3300013308 Bacteria 1046
51 Ga0157375_12738751 3300013308 Bacteria 589
52 Ga0207642_10096153 3300025899 Bacteria 1476
53 Ga0207680_10785643 3300025903 Bacteria 682
54 Ga0207695_10594082 3300025913 Bacteria 988
55 Ga0207700_10889799 3300025928 Bacteria 797
56 Ga0207706_10039150 3300025933 Bacteria 4203
57 Ga0207686_10608124 3300025934 Bacteria 861
58 Ga0207712_10678289 3300025961 Bacteria 898
59 Ga0207668_11676493 3300025972 Bacteria 574
60 Ga0207640_11284615 3300025981 Bacteria 653
61 Ga0207683_10887098 3300026121 Bacteria 828
62 Ga0268264_11216698 3300028381 Bacteria 763
63 Ga0307517_10251593 3300028786 Bacteria 1036
64 Ga0307509_10000015 3300031507 Bacteria 276050
65 Ga0307509_10259798 3300031507 Bacteria 1513
66 Ga0307516_10215281 3300031730 Bacteria 1633
67 Ga0307406_10086835 3300031901 Bacteria 2096
68 Ga0307412_10106778 3300031911 Bacteria 1991
69 Ga0307416_102168232 3300032002 Bacteria 657
70 Ga0307415_100197903 3300032126 Bacteria 1591
71 Ga0307415_100367268 3300032126 Bacteria 1217
72 Ga0307507_10046326 3300033179 Bacteria 4264
73 Ga0307510_10528389 3300033180 Bacteria 624
74 Ga0373957_0448797 3300035120 Bacteria 558
75 Ga0395900_0187527 3300037418 Bacteria 2099
76 Ga0395900_1565618 3300037418 Bacteria 571
77 Ga0395898_0019089 3300037466 Bacteria 6979
78 Ga0395898_1308603 3300037466 Bacteria 654
79 Ga0395905_0430122 3300037471 Bacteria 1217
80 Ga0395901_0102771 3300038443 Bacteria 2999
81 Ga0395901_2022685 3300038443 Bacteria 522
82 Ga0451791_0239615 3300041451 Bacteria 621
83 Ga0451793_0937018 3300041452 Bacteria 1088
84 Ga0451849_0084617 3300041505 Bacteria 719
85 Ga0451853_2626329 3300041512 Bacteria 761
86 Ga0451853_3571468 3300041512 Bacteria 1370
87 Ga0439448_0112043 3300042005 Bacteria 932
88 Ga0439450_059508 3300042008 Bacteria 921
89 Ga0439454_009936 3300042011 Bacteria 1245
90 Ga0439463_108262 3300042016 Bacteria 717
91 Ga0450915_010027 3300042119 Bacteria 656
92 Ga0439444_0027231 3300042437 Bacteria 1051
93 Ga0439460_0012715 3300042461 Bacteria 2189
94 Ga0439440_0047400 3300042993 Bacteria 1064
95 Ga0466972_0047049 3300044658 Bacteria 2087
96 Ga0453684_0280262 3300044712 Bacteria 1901
97 Ga0466970_0096127 3300044765 Bacteria 1611
98 Ga0466967_1364626 3300045976 Bacteria 706
99 Ga0466967_2067342 3300045976 Bacteria 566
100 Ga0495641_0017919 3300046461 Bacteria 3670
101 Ga0495582_0249026 3300046473 Bacteria 1019
102 Ga0495584_0308000 3300046491 Bacteria 804
103 Ga0495585_0135944 3300046492 Bacteria 1291
104 Ga0495594_0065108 3300046499 Bacteria 2022
105 Ga0495632_0125613 3300046519 Bacteria 1196
106 Ga0495642_0209228 3300046528 Bacteria 851
107 Ga0495645_0665867 3300046543 Bacteria 635
108 Ga0495656_0135894 3300046615 Bacteria 1174
109 Ga0495636_0066844 3300047318 Bacteria 1529
110 Ga0495685_153404 3300047447 Bacteria 748
111 Ga0495615_0167678 3300048090 Bacteria 663
112 Ga0496100_0247488 3300048903 Bacteria 1317
113 Ga0496102_0221165 3300048905 Bacteria 1785
114 Ga0496104_0196521 3300048907 Bacteria 1929
115 Ga0496108_0237577 3300048911 Bacteria 1585
116 Ga0496108_0705623 3300048911 Bacteria 875
117 Ga0496108_1359655 3300048911 Bacteria 595
118 Ga0496109_0015218 3300048912 Bacteria 6697
119 Ga0496109_0171350 3300048912 Bacteria 2036
120 Ga0496110_0795439 3300048913 Bacteria 850
121 Ga0496110_1276342 3300048913 Bacteria 643
122 Ga0496112_1479622 3300048915 Bacteria 593
123 Ga0496113_0097903 3300048916 Bacteria 2270
124 Ga0496113_0541442 3300048916 Bacteria 934
125 Ga0496114_0060311 3300048917 Bacteria 3170
126 Ga0496114_0377731 3300048917 Bacteria 1254
127 Ga0496115_0143325 3300048918 Bacteria 1971
128 Ga0496120_0019728 3300048923 Bacteria 4305
129 Ga0501034_0242377 3300049571 Bacteria 1749
130 Ga0501036_0000538 3300049572 Bacteria 27128
131 Ga0501036_0141395 3300049572 Bacteria 2031
132 Ga0501037_0069844 3300049573 Bacteria 2557
133 Ga0501038_0143524 3300049574 Bacteria 1951
134 Ga0501038_1145653 3300049574 Bacteria 566
135 Ga0501040_0012079 3300049576 Bacteria 5653
136 Ga0501041_0178795 3300049577 Bacteria 1328
137 Ga0501042_0226780 3300049578 Bacteria 1347
138 Ga0501048_0181396 3300049582 Bacteria 1492
139 Ga0501048_0460232 3300049582 Bacteria 911
140 Ga0501071_0197473 3300049587 Bacteria 1510
141 Ga0501072_0573991 3300049588 Bacteria 890
142 Ga0501074_0672498 3300049590 Bacteria 731
143 Ga0501075_0617017 3300049591 Bacteria 827
144 Ga0501076_0329302 3300049592 Bacteria 1253
145 Ga0501079_0828059 3300049741 Bacteria 729
146 Ga0501045_0022908 3300049824 Bacteria 4474
147 Ga0501045_0919995 3300049824 Bacteria 642
148 nmdc:mga05p37_13198_c1 3300050507 Bacteria 9889
149 nmdc:mga05p37_71460_c1 3300050507 Bacteria 4269
150 nmdc:mga05p37_799141_c1 3300050507 Bacteria 1032
151 nmdc:mga09592_1370743_c1 3300050508 Bacteria 579
152 nmdc:mga09592_332409_c1 3300050508 Bacteria 1316
153 nmdc:mga09592_811285_c1 3300050508 Bacteria 791
154 nmdc:mga0qj67_48_c1 3300050509 Bacteria 85487
155 nmdc:mga06r32_106441_c1 3300050510 Bacteria 2756
156 nmdc:mga0n895_51653_c1 3300050512 Bacteria 4033
157 nmdc:mga0rr50_403630_c1 3300050513 Bacteria 1155
158 nmdc:mga0a205_67086_c1 3300050515 Bacteria 3466
159 Ga0500635_0167815 3300053080 Bacteria 844
160 Ga0495655_0036323 3300053083 Bacteria 1231
161 Ga0495595_0441702 3300053084 Bacteria 661
162 Ga0495619_0159531 3300053085 Bacteria 1557
163 Ga0500578_0074412 3300053086 Bacteria 2164
164 Ga0500583_0040310 3300053092 Bacteria 2115
165 Ga0500583_0419615 3300053092 Bacteria 639
166 Ga0500566_0529787 3300053094 Bacteria 502
167 Ga0500641_0040166 3300053096 Bacteria 1888
168 Ga0500654_060297 3300053099 Bacteria 1949
169 Ga0500628_149778 3300053129 Bacteria 652
170 Ga0500652_209670 3300053131 Bacteria 788
171 Ga0500564_076057 3300053138 Bacteria 1510
172 Ga0500588_0017952 3300053146 Bacteria 1856
173 Ga0500620_036549 3300053155 Bacteria 1589
174 Ga0500596_034307 3300053735 Bacteria 795
175 Ga0501084_0004875 3300054114 Bacteria 10958
176 Ga0501082_0164288 3300060353 Bacteria 1929
177 Ga0466962_0604125 3300061719 Bacteria 559
178 2795784730 2795385470 Bacteria 8317180
179 2809198676 2808606439 Bacteria 5952208
180 2895430111 2895427314 Bacteria 13147766
181 Ga0439440_0089882
182 rootH1_10131781
183 JGI25407J50210_10018523
184 Ga0070683_101993133
185 Ga0070666_10815290
186 Ga0070682_100192161
187 Ga0070674_100057036
188 Ga0070710_10321518
189 Ga0070678_100356044
190 Ga0070698_100303043
191 Ga0068866_10099362
192 Ga0068861_100162654
193 Ga0068870_10804088
194 Ga0081455_10065624
195 Ga0081538_10001165
196 Ga0081538_10114837
197 Ga0081538_10172705
198 Ga0081540_1155349
199 Ga0081539_10215524
200 Ga0081539_10304165
201 Ga0070717_10139666
202 Ga0070717_10432275
203 Ga0097621_100621282
204 Ga0075428_100013620
205 Ga0075428_100464176
206 Ga0075430_100327815
207 Ga0075430_100503302
208 Ga0075431_100410476
209 Ga0075433_10001894
210 Ga0075434_100039806
211 Ga0075429_100075429
212 Ga0075429_100897637
213 Ga0075435_100372485
214 Ga0105240_10958428
215 Ga0111539_10222500
216 Ga0105245_11411996
217 Ga0105247_11095947
218 Ga0114129_10003457
219 Ga0105243_10509525
220 Ga0105242_10680521
221 Ga0105249_10554442
222 Ga0105239_11399050
223 Ga0157371_10412963
224 Ga0157378_10058701
225 Ga0157378_10682684
226 Ga0163162_10938528
227 Ga0157372_11669417
228 Ga0157372_12022823
229 Ga0157372_12036875
230 Ga0157375_10871831
231 Ga0157375_12738751
232 Ga0207642_10096153
233 Ga0207680_10785643
234 Ga0207695_10594082
235 Ga0207700_10889799
236 Ga0207706_10039150
237 Ga0207686_10608124
238 Ga0207712_10678289
239 Ga0207668_11676493
240 Ga0207640_11284615
241 Ga0207683_10887098
242 Ga0268264_11216698
243 Ga0307517_10251593
244 Ga0307509_10000015
245 Ga0307509_10259798
246 Ga0307516_10215281
247 Ga0307406_10086835
248 Ga0307412_10106778
249 Ga0307416_102168232
250 Ga0307415_100197903
251 Ga0307415_100367268
252 Ga0307507_10046326
253 Ga0307510_10528389
254 Ga0373957_0448797
255 Ga0395900_0187527
256 Ga0395900_1565618
257 Ga0395898_0019089
258 Ga0395898_1308603
259 Ga0395905_0430122
260 Ga0395901_0102771
261 Ga0395901_2022685
262 Ga0451791_0239615
263 Ga0451793_0937018
264 Ga0451849_0084617
265 Ga0451853_2626329
266 Ga0451853_3571468
267 Ga0439448_0112043
268 Ga0439450_059508
269 Ga0439454_009936
270 Ga0439463_108262
271 Ga0450915_010027
272 Ga0439444_0027231
273 Ga0439460_0012715
274 Ga0439440_0047400
275 Ga0466972_0047049
276 Ga0453684_0280262
277 Ga0466970_0096127
278 Ga0466967_1364626
279 Ga0466967_2067342
280 Ga0495641_0017919
281 Ga0495582_0249026
282 Ga0495584_0308000
283 Ga0495585_0135944
284 Ga0495594_0065108
285 Ga0495632_0125613
286 Ga0495642_0209228
287 Ga0495645_0665867
288 Ga0495656_0135894
289 Ga0495636_0066844
290 Ga0495685_153404
291 Ga0495615_0167678
292 Ga0496100_0247488
293 Ga0496102_0221165
294 Ga0496104_0196521
295 Ga0496108_0237577
296 Ga0496108_0705623
297 Ga0496108_1359655
298 Ga0496109_0015218
299 Ga0496109_0171350
300 Ga0496110_0795439
301 Ga0496110_1276342
302 Ga0496112_1479622
303 Ga0496113_0097903
304 Ga0496113_0541442
305 Ga0496114_0060311
306 Ga0496114_0377731
307 Ga0496115_0143325
308 Ga0496120_0019728
309 Ga0501034_0242377
310 Ga0501036_0000538
311 Ga0501036_0141395
312 Ga0501037_0069844
313 Ga0501038_0143524
314 Ga0501038_1145653
315 Ga0501040_0012079
316 Ga0501041_0178795
317 Ga0501042_0226780
318 Ga0501048_0181396
319 Ga0501048_0460232
320 Ga0501071_0197473
321 Ga0501072_0573991
322 Ga0501074_0672498
323 Ga0501075_0617017
324 Ga0501076_0329302
325 Ga0501079_0828059
326 Ga0501045_0022908
327 Ga0501045_0919995
328 nmdc:mga05p37_13198_c1
329 nmdc:mga05p37_71460_c1
330 nmdc:mga05p37_799141_c1
331 nmdc:mga09592_1370743_c1
332 nmdc:mga09592_332409_c1
333 nmdc:mga09592_811285_c1
334 nmdc:mga0qj67_48_c1
335 nmdc:mga06r32_106441_c1
336 nmdc:mga0n895_51653_c1
337 nmdc:mga0rr50_403630_c1
338 nmdc:mga0a205_67086_c1
339 Ga0500635_0167815
340 Ga0495655_0036323
341 Ga0495595_0441702
342 Ga0495619_0159531
343 Ga0500578_0074412
344 Ga0500583_0040310
345 Ga0500583_0419615
346 Ga0500566_0529787
347 Ga0500641_0040166
348 Ga0500654_060297
349 Ga0500628_149778
350 Ga0500652_209670
351 Ga0500564_076057
352 Ga0500588_0017952
353 Ga0500620_036549
354 Ga0500596_034307
355 Ga0501084_0004875
356 Ga0501082_0164288
357 Ga0466962_0604125
358 2795784730
359 2809198676
360 2895430111

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06304

DUF1048

Protein of unknown function (DUF1048)

9

110

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o3l-assembly2.cif.gz_B crystal structure of a duf1048 protein with a left-handed superhelix fold (bce_3448) from bacillus cereus atcc 10987 at 2.05 a resolution 0.9124 21 95
2o3l-assembly2.cif.gz_B crystal structure of a duf1048 protein with a left-handed superhelix fold (bce_3448) from bacillus cereus atcc 10987 at 2.05 a resolution 0.8293 21 95
2o4t-assembly1.cif.gz_A-2 crystal structure of a protein of the duf1048 family with a left-handed superhelix fold (bh3976) from bacillus halodurans at 1.95 a resolution 0.7749 24 112
2hh6-assembly1.cif.gz_A-2 crystal structure of bh3980 (10176605) from bacillus halodurans at 2.04 a resolution 0.7569 5 112
2o4t-assembly1.cif.gz_A-2 crystal structure of a protein of the duf1048 family with a left-handed superhelix fold (bh3976) from bacillus halodurans at 1.95 a resolution 0.7354 24 112
ID Description Score Start End Superfamily
2o3lB00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;c-terminal domain of poly(a) binding protein 0.8831 23 95 1.10.1900.10
2o3lB00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;c-terminal domain of poly(a) binding protein 0.8079 23 95 1.10.1900.10
2o4tA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;c-terminal domain of poly(a) binding protein 0.7749 24 112 1.10.1900.10
2hh6A00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;c-terminal domain of poly(a) binding protein 0.7589 10 112 1.10.1900.10
2o4tA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;c-terminal domain of poly(a) binding protein 0.7354 24 112 1.10.1900.10
ID Description Score Start End GO Terms
AF-A0A376H2V5-F1-model_v4 DUF1048 family protein 0.9161 12 94
AF-A0A7X0SCD9-F1-model_v4 DUF1048 domain-containing protein 0.9157 21 94 GO:0016020
AF-A0A7Y8TJP1-F1-model_v4 deleted 0.9105 1 102
AF-A0A2R7RC08-F1-model_v4 DUF1048 domain-containing protein 0.9059 5 83
AF-A0A4Y5F741-F1-model_v4 DUF1129 family protein 0.9052 14 92 GO:0016020

Map