F275861

General Info

Members Datasets Scaffolds Average Seq Length
180 46 360 185

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10150930|Ga0316576_101509303
Length 213
Sequence MLISEIKENIMFTEYHKIEEDAMDQVGTANVDLKDLESQIAELRGRVDVMDKKSPSNKLSMVVFSGDMDKVLAAFVIATGAVAMGMEAVMFFTFWGTPVLRDKKKSVGGKDVMGKMFSAMLPKGTCEVKLSKMNMGGMGTAMMKSLMKKKNVASLEQMLEMAEELGVRLYVCEMSMDLMGFKRDEMIDYNAMEFCGVAKFLEEANGSRIQLFI

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
6 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
7 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
8 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
9 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
10 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
11 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
12 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
13 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
14 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
15 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
16 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
17 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
18 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
19 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
20 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
21 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
22 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
23 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
24 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
25 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
28 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
29 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
30 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
31 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
32 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
33 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
34 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
35 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
36 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
37 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
38 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
39 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
40 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
41 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
42 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
43 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
44 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
45 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
46 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.78
Metatranscriptomes 27.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 86.11
Stem 0
Stem Tuber 0
Unclassified 17.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10150930 3300031727 Bacteria 1751
2 rootL2_10366758 3300003322 Bacteria 1150
3 Ga0070692_10031666 3300005345 Unclassified 2653
4 Ga0070669_100141807 3300005353 Unclassified 1853
5 Ga0070665_100626945 3300005548 Bacteria 1088
6 Ga0068858_100164329 3300005842 Unclassified 2091
7 Ga0207703_10129306 3300026035 Unclassified 2179
8 Ga0268266_11485407 3300028379 Unclassified 653
9 Ga0265334_10086832 3300028573 Bacteria 1146
10 Ga0265336_10009166 3300028666 Bacteria 3433
11 Ga0265338_10020528 3300028800 Bacteria 6946
12 Ga0265338_10276624 3300028800 Bacteria 1228
13 Ga0265330_10009520 3300031235 Unclassified 4615
14 Ga0265332_10218207 3300031238 Bacteria 791
15 Ga0265320_10335476 3300031240 Bacteria 668
16 Ga0265340_10167288 3300031247 Bacteria 997
17 Ga0265316_10002821 3300031344 Bacteria 17779
18 Ga0265316_10005537 3300031344 Bacteria 12248
19 Ga0265316_10049866 3300031344 Unclassified 3295
20 Ga0316575_10001682 3300031665 Bacteria 7231
21 Ga0316575_10002000 3300031665 Bacteria 6764
22 Ga0316575_10005038 3300031665 Unclassified 4680
23 Ga0316575_10036621 3300031665 Bacteria 1930
24 Ga0316575_10110596 3300031665 Bacteria 1121
25 Ga0316579_10022905 3300031691 Bacteria 2798
26 Ga0316579_10059808 3300031691 Bacteria 1791
27 Ga0316579_10061451 3300031691 Unclassified 1768
28 Ga0316579_10064649 3300031691 Bacteria 1725
29 Ga0316579_10078024 3300031691 Bacteria 1575
30 Ga0316579_10112591 3300031691 Bacteria 1306
31 Ga0265342_10004034 3300031712 Bacteria 11724
32 Ga0316576_10000928 3300031727 Bacteria 14960
33 Ga0316576_10012087 3300031727 Bacteria 5692
34 Ga0316576_10015694 3300031727 Bacteria 5091
35 Ga0316576_10027753 3300031727 Bacteria 3982
36 Ga0316576_10048163 3300031727 Bacteria 3090
37 Ga0316576_10053435 3300031727 Bacteria 2943
38 Ga0316576_10054664 3300031727 Bacteria 2912
39 Ga0316576_10063355 3300031727 Bacteria 2714
40 Ga0316576_10132310 3300031727 Unclassified 1876
41 Ga0316576_10199765 3300031727 Bacteria 1506
42 Ga0316576_10251433 3300031727 Bacteria 1327
43 Ga0316576_10266577 3300031727 Bacteria 1284
44 Ga0316576_10338564 3300031727 Bacteria 1121
45 Ga0316578_10001729 3300031728 Bacteria 9123
46 Ga0316578_10002757 3300031728 Bacteria 7824
47 Ga0316578_10002987 3300031728 Bacteria 7611
48 Ga0316578_10017075 3300031728 Bacteria 3943
49 Ga0316578_10079931 3300031728 Bacteria 1945
50 Ga0316578_10087812 3300031728 Bacteria 1855
51 Ga0316578_10261827 3300031728 Bacteria 1037
52 Ga0316578_10309242 3300031728 Unclassified 944
53 Ga0316578_10464775 3300031728 Bacteria 747
54 Ga0316577_10017216 3300031733 Bacteria 3989
55 Ga0316577_10041424 3300031733 Bacteria 2577
56 Ga0316577_10084680 3300031733 Bacteria 1774
57 Ga0316577_10098448 3300031733 Bacteria 1638
58 Ga0316577_10209048 3300031733 Bacteria 1103
59 Ga0316583_10000942 3300032133 Bacteria 9358
60 Ga0316583_10067397 3300032133 Bacteria 1252
61 Ga0316583_10098487 3300032133 Bacteria 1019
62 Ga0316583_10107643 3300032133 Bacteria 971
63 Ga0316585_10077673 3300032137 Unclassified 1081
64 Ga0316585_10095029 3300032137 Unclassified 976
65 Ga0316585_10179420 3300032137 Unclassified 700
66 Ga0316580_10032346 3300032139 Bacteria 1619
67 Ga0316593_10004285 3300032168 Bacteria 3648
68 Ga0316593_10011787 3300032168 Bacteria 2551
69 Ga0316593_10012475 3300032168 Bacteria 2494
70 Ga0316593_10016303 3300032168 Unclassified 2250
71 Ga0316593_10016672 3300032168 Bacteria 2230
72 Ga0316593_10021151 3300032168 Bacteria 2031
73 Ga0316593_10022809 3300032168 Bacteria 1970
74 Ga0316593_10025165 3300032168 Bacteria 1893
75 Ga0316593_10029703 3300032168 Bacteria 1770
76 Ga0316593_10030957 3300032168 Bacteria 1740
77 Ga0316593_10039103 3300032168 Bacteria 1573
78 Ga0316593_10039825 3300032168 Bacteria 1560
79 Ga0316593_10045852 3300032168 Bacteria 1466
80 Ga0316593_10048493 3300032168 Bacteria 1430
81 Ga0316593_10049550 3300032168 Bacteria 1416
82 Ga0316593_10053663 3300032168 Bacteria 1366
83 Ga0316593_10075859 3300032168 Unclassified 1168
84 Ga0316593_10130305 3300032168 Bacteria 907
85 Ga0316592_1002340 3300033524 Bacteria 3262
86 Ga0316592_1004537 3300033524 Bacteria 2585
87 Ga0316592_1011054 3300033524 Bacteria 1828
88 Ga0316592_1011976 3300033524 Bacteria 1772
89 Ga0316592_1015566 3300033524 Bacteria 1584
90 Ga0316592_1015715 3300033524 Bacteria 1578
91 Ga0316592_1015892 3300033524 Bacteria 1570
92 Ga0316592_1023408 3300033524 Bacteria 1326
93 Ga0316592_1023612 3300033524 Unclassified 1321
94 Ga0316592_1023778 3300033524 Unclassified 1316
95 Ga0316592_1024632 3300033524 Bacteria 1295
96 Ga0316592_1056701 3300033524 Unclassified 877
97 Ga0316592_1085729 3300033524 Bacteria 718
98 Ga0316592_1096403 3300033524 Bacteria 679
99 Ga0316586_1004388 3300033527 Bacteria 1924
100 Ga0316586_1017831 3300033527 Bacteria 1148
101 Ga0316586_1032937 3300033527 Bacteria 893
102 Ga0316588_1003259 3300033528 Bacteria 2937
103 Ga0316588_1032393 3300033528 Bacteria 1229
104 Ga0316588_1034243 3300033528 Bacteria 1199
105 Ga0316588_1097589 3300033528 Unclassified 734
106 Ga0316588_1139550 3300033528 Bacteria 619
107 Ga0316596_1009010 3300033541 Bacteria 2390
108 Ga0316596_1011010 3300033541 Bacteria 2201
109 Ga0316596_1012274 3300033541 Bacteria 2106
110 Ga0316596_1021451 3300033541 Unclassified 1647
111 Ga0316596_1024460 3300033541 Unclassified 1551
112 Ga0316596_1027362 3300033541 Bacteria 1471
113 Ga0316596_1033601 3300033541 Bacteria 1337
114 Ga0316596_1045653 3300033541 Unclassified 1156
115 Ga0316596_1075879 3300033541 Bacteria 902
116 Ga0316574_0001759 3300035398 Bacteria 10506
117 Ga0316574_0002228 3300035398 Bacteria 9646
118 Ga0316574_0048371 3300035398 Bacteria 2641
119 Ga0316574_0067361 3300035398 Bacteria 2257
120 Ga0316574_0720354 3300035398 Bacteria 611
121 Ga0316582_0000273 3300036647 Bacteria 17633
122 Ga0316582_0015787 3300036647 Bacteria 4329
123 Ga0316582_0059113 3300036647 Bacteria 2454
124 Ga0316582_0065251 3300036647 Unclassified 2344
125 Ga0316582_0142153 3300036647 Bacteria 1618
126 Ga0316582_0188368 3300036647 Bacteria 1405
127 Ga0316582_0231338 3300036647 Bacteria 1265
128 Ga0316582_0314348 3300036647 Bacteria 1076
129 Ga0316584_0004105 3300036712 Bacteria 9600
130 Ga0316584_0010519 3300036712 Bacteria 6471
131 Ga0316584_0018398 3300036712 Bacteria 5041
132 Ga0316584_0076102 3300036712 Bacteria 2515
133 Ga0316584_0161668 3300036712 Bacteria 1663
134 Ga0316584_0188563 3300036712 Bacteria 1525
135 Ga0316584_0212836 3300036712 Unclassified 1422
136 Ga0316584_0225602 3300036712 Bacteria 1375
137 Ga0316584_0238391 3300036712 Unclassified 1332
138 Ga0316584_0252619 3300036712 Bacteria 1288
139 Ga0316584_0298490 3300036712 Bacteria 1167
140 Ga0316584_0607112 3300036712 Unclassified 758
141 Ga0316584_0845149 3300036712 Bacteria 619
142 Ga0316581_0087669 3300037588 Bacteria 958
143 Ga0400484_13781 3300038725 Bacteria 12953
144 Ga0400490_02345 3300038726 Bacteria 3714
145 Ga0400490_04316 3300038726 Bacteria 1274
146 Ga0400490_25453 3300038726 Bacteria 4480
147 Ga0400491_02588 3300038727 Unclassified 1013
148 Ga0400485_00645 3300038735 Bacteria 13130
149 Ga0400485_00694 3300038735 Bacteria 1443
150 Ga0400488_09986 3300038741 Bacteria 3600
151 Ga0400488_43885 3300038741 Bacteria 3319
152 Ga0400488_51960 3300038741 Unclassified 1310
153 Ga0400486_20664 3300038742 Bacteria 12634
154 Ga0400486_26664 3300038742 Bacteria 5118
155 Ga0400483_015326 3300039062 Bacteria 10769
156 Ga0400483_060067 3300039062 Bacteria 3419
157 Ga0400483_070945 3300039062 Bacteria 6545
158 Ga0400483_175209 3300039062 Bacteria 7377
159 Ga0400483_184961 3300039062 Unclassified 2686
160 Ga0400483_242620 3300039062 Bacteria 5820
161 Ga0400489_13486 3300039093 Bacteria 11587
162 Ga0400489_39506 3300039093 Bacteria 8258
163 Ga0400489_79275 3300039093 Bacteria 18981
164 Ga0400489_88029 3300039093 Bacteria 25055
165 Ga0400487_39880 3300039110 Bacteria 12901
166 Ga0400487_60257 3300039110 Bacteria 1153
167 Ga0451577_0026897 3300042876 Bacteria 5208
168 Ga0453683_0052316 3300044673 Bacteria 2557
169 Ga0453683_0173352 3300044673 Unclassified 1366
170 Ga0453683_0474810 3300044673 Bacteria 810
171 Ga0453683_0682455 3300044673 Bacteria 672
172 Ga0453684_0002399 3300044712 Bacteria 45652
173 Ga0453684_0024655 3300044712 Bacteria 8777
174 Ga0453684_0027337 3300044712 Bacteria 8186
175 Ga0453684_0081977 3300044712 Bacteria 4021
176 Ga0453684_0239055 3300044712 Bacteria 2092
177 Ga0451576_0000011 3300045051 Bacteria 676436
178 Ga0451576_0000035 3300045051 Bacteria 379076
179 Ga0451576_0548779 3300045051 Bacteria 1214
180 Ga0451576_0635868 3300045051 Bacteria 1121
181 Ga0316576_10150930
182 rootL2_10366758
183 Ga0070692_10031666
184 Ga0070669_100141807
185 Ga0070665_100626945
186 Ga0068858_100164329
187 Ga0207703_10129306
188 Ga0268266_11485407
189 Ga0265334_10086832
190 Ga0265336_10009166
191 Ga0265338_10020528
192 Ga0265338_10276624
193 Ga0265330_10009520
194 Ga0265332_10218207
195 Ga0265320_10335476
196 Ga0265340_10167288
197 Ga0265316_10002821
198 Ga0265316_10005537
199 Ga0265316_10049866
200 Ga0316575_10001682
201 Ga0316575_10002000
202 Ga0316575_10005038
203 Ga0316575_10036621
204 Ga0316575_10110596
205 Ga0316579_10022905
206 Ga0316579_10059808
207 Ga0316579_10061451
208 Ga0316579_10064649
209 Ga0316579_10078024
210 Ga0316579_10112591
211 Ga0265342_10004034
212 Ga0316576_10000928
213 Ga0316576_10012087
214 Ga0316576_10015694
215 Ga0316576_10027753
216 Ga0316576_10048163
217 Ga0316576_10053435
218 Ga0316576_10054664
219 Ga0316576_10063355
220 Ga0316576_10132310
221 Ga0316576_10199765
222 Ga0316576_10251433
223 Ga0316576_10266577
224 Ga0316576_10338564
225 Ga0316578_10001729
226 Ga0316578_10002757
227 Ga0316578_10002987
228 Ga0316578_10017075
229 Ga0316578_10079931
230 Ga0316578_10087812
231 Ga0316578_10261827
232 Ga0316578_10309242
233 Ga0316578_10464775
234 Ga0316577_10017216
235 Ga0316577_10041424
236 Ga0316577_10084680
237 Ga0316577_10098448
238 Ga0316577_10209048
239 Ga0316583_10000942
240 Ga0316583_10067397
241 Ga0316583_10098487
242 Ga0316583_10107643
243 Ga0316585_10077673
244 Ga0316585_10095029
245 Ga0316585_10179420
246 Ga0316580_10032346
247 Ga0316593_10004285
248 Ga0316593_10011787
249 Ga0316593_10012475
250 Ga0316593_10016303
251 Ga0316593_10016672
252 Ga0316593_10021151
253 Ga0316593_10022809
254 Ga0316593_10025165
255 Ga0316593_10029703
256 Ga0316593_10030957
257 Ga0316593_10039103
258 Ga0316593_10039825
259 Ga0316593_10045852
260 Ga0316593_10048493
261 Ga0316593_10049550
262 Ga0316593_10053663
263 Ga0316593_10075859
264 Ga0316593_10130305
265 Ga0316592_1002340
266 Ga0316592_1004537
267 Ga0316592_1011054
268 Ga0316592_1011976
269 Ga0316592_1015566
270 Ga0316592_1015715
271 Ga0316592_1015892
272 Ga0316592_1023408
273 Ga0316592_1023612
274 Ga0316592_1023778
275 Ga0316592_1024632
276 Ga0316592_1056701
277 Ga0316592_1085729
278 Ga0316592_1096403
279 Ga0316586_1004388
280 Ga0316586_1017831
281 Ga0316586_1032937
282 Ga0316588_1003259
283 Ga0316588_1032393
284 Ga0316588_1034243
285 Ga0316588_1097589
286 Ga0316588_1139550
287 Ga0316596_1009010
288 Ga0316596_1011010
289 Ga0316596_1012274
290 Ga0316596_1021451
291 Ga0316596_1024460
292 Ga0316596_1027362
293 Ga0316596_1033601
294 Ga0316596_1045653
295 Ga0316596_1075879
296 Ga0316574_0001759
297 Ga0316574_0002228
298 Ga0316574_0048371
299 Ga0316574_0067361
300 Ga0316574_0720354
301 Ga0316582_0000273
302 Ga0316582_0015787
303 Ga0316582_0059113
304 Ga0316582_0065251
305 Ga0316582_0142153
306 Ga0316582_0188368
307 Ga0316582_0231338
308 Ga0316582_0314348
309 Ga0316584_0004105
310 Ga0316584_0010519
311 Ga0316584_0018398
312 Ga0316584_0076102
313 Ga0316584_0161668
314 Ga0316584_0188563
315 Ga0316584_0212836
316 Ga0316584_0225602
317 Ga0316584_0238391
318 Ga0316584_0252619
319 Ga0316584_0298490
320 Ga0316584_0607112
321 Ga0316584_0845149
322 Ga0316581_0087669
323 Ga0400484_13781
324 Ga0400490_02345
325 Ga0400490_04316
326 Ga0400490_25453
327 Ga0400491_02588
328 Ga0400485_00645
329 Ga0400485_00694
330 Ga0400488_09986
331 Ga0400488_43885
332 Ga0400488_51960
333 Ga0400486_20664
334 Ga0400486_26664
335 Ga0400483_015326
336 Ga0400483_060067
337 Ga0400483_070945
338 Ga0400483_175209
339 Ga0400483_184961
340 Ga0400483_242620
341 Ga0400489_13486
342 Ga0400489_39506
343 Ga0400489_79275
344 Ga0400489_88029
345 Ga0400487_39880
346 Ga0400487_60257
347 Ga0451577_0026897
348 Ga0453683_0052316
349 Ga0453683_0173352
350 Ga0453683_0474810
351 Ga0453683_0682455
352 Ga0453684_0002399
353 Ga0453684_0024655
354 Ga0453684_0027337
355 Ga0453684_0081977
356 Ga0453684_0239055
357 Ga0451576_0000011
358 Ga0451576_0000035
359 Ga0451576_0548779
360 Ga0451576_0635868

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13686

DrsE_2

DsrE/DsrF/DrsH-like family

55

212

0.97

PF02635

DsrE

DsrE/DsrF-like family

58

207

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pnx-assembly2.cif.gz_E crystal structure of a putative sulfurtransferase dsre (swol_2425) from syntrophomonas wolfei str. goettingen at 1.92 a resolution 0.9469 32 184
3pnx-assembly2.cif.gz_E crystal structure of a putative sulfurtransferase dsre (swol_2425) from syntrophomonas wolfei str. goettingen at 1.92 a resolution 0.9182 32 184
2qs7-assembly2.cif.gz_D crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution 0.8362 32 184
3mc3-assembly1.cif.gz_A crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution 0.8247 30 184
2qs7-assembly2.cif.gz_D crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution 0.8191 32 184
ID Description Score Start End Superfamily
af_Q2G1R7_198_355_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.9727 31 184 3.40.1260.10
af_Q2G1R7_198_355_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.9426 31 184 3.40.1260.10
3pnxE00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.9185 32 184 3.40.1260.10
3pnxE00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.9068 32 184 3.40.1260.10
af_Q58396_1_114_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8554 32 184 3.40.1260.10
ID Description Score Start End GO Terms
AF-A0A7V5ZG77-F1-model_v4 NADH dehydrogenase FAD-containing subunit 0.9967 28 184 GO:0016020
AF-A0A7V5ZG77-F1-model_v4 NADH dehydrogenase FAD-containing subunit 0.9904 28 184 GO:0016020
AF-G6C4G2-F1-model_v4 Rhodanese domain-containing protein 0.9869 32 184 GO:0016491
AF-A0A3C0ESD6-F1-model_v4 Peroxiredoxin family protein 0.9834 30 184 GO:0016020
AF-A0A7V3AN83-F1-model_v4 Peroxiredoxin family protein 0.9828 34 184 GO:0016020

Map