F275080

General Info

Members Datasets Scaffolds Average Seq Length
180 128 360 117

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100044553|Ga0070669_1000445534
Length 130
Sequence MSRRLKLMIAAGIGLAALAGGTAYAYVMQDAAAQLRASGVVGEQADGYLGLVGSASADVRAQMDSVNIQRRAAYTQLASQRGATIEEVAAATACQIFGNRVGPGQYYRLPDGVWRRRNGSEPVPRPSHCG

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
104 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
126 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
127 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.67
Nodule 0
Rhizoplane 2.78
Rhizosphere 92.22
Stem 0
Stem Tuber 0
Unclassified 3.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100044553 3300005353 Bacteria 3232
2 Ga0070683_100269490 3300005329 Bacteria 1619
3 Ga0070670_100843884 3300005331 Bacteria 829
4 Ga0070677_10001946 3300005333 Bacteria 6550
5 Ga0070677_10374131 3300005333 Bacteria 744
6 Ga0068869_100105248 3300005334 Bacteria 2140
7 Ga0068869_101793250 3300005334 Bacteria 549
8 Ga0070680_100135544 3300005336 Bacteria 2062
9 Ga0068868_100000122 3300005338 Bacteria 49376
10 Ga0068868_100697563 3300005338 Bacteria 908
11 Ga0070660_100000521 3300005339 Bacteria 25661
12 Ga0070668_100661985 3300005347 Bacteria 918
13 Ga0070675_100423864 3300005354 Bacteria 1190
14 Ga0070675_100507903 3300005354 Bacteria 1087
15 Ga0070673_100318969 3300005364 Bacteria 1372
16 Ga0070673_101391004 3300005364 Bacteria 660
17 Ga0070659_100000032 3300005366 Bacteria 120241
18 Ga0070667_101955124 3300005367 Bacteria 552
19 Ga0070714_101743162 3300005435 Bacteria 608
20 Ga0070662_100693581 3300005457 Bacteria 861
21 Ga0070681_11186769 3300005458 Bacteria 685
22 Ga0068867_100896787 3300005459 Bacteria 797
23 Ga0070684_100209304 3300005535 Bacteria 1777
24 Ga0070672_100240614 3300005543 Bacteria 1522
25 Ga0070686_100000526 3300005544 Bacteria 22933
26 Ga0070686_101080078 3300005544 Bacteria 662
27 Ga0070665_100000616 3300005548 Bacteria 48794
28 Ga0070665_100075487 3300005548 Bacteria 3378
29 Ga0068855_100081094 3300005563 Bacteria 3761
30 Ga0068854_100281318 3300005578 Bacteria 1340
31 Ga0070702_101032096 3300005615 Bacteria 653
32 Ga0068852_101470196 3300005616 Bacteria 704
33 Ga0068859_100535631 3300005617 Bacteria 1266
34 Ga0068864_100405234 3300005618 Bacteria 1297
35 Ga0068864_101983945 3300005618 Bacteria 588
36 Ga0068863_100323829 3300005841 Bacteria 1497
37 Ga0068863_100698930 3300005841 Bacteria 1008
38 Ga0068858_101168911 3300005842 Bacteria 756
39 Ga0068860_102458077 3300005843 Bacteria 541
40 Ga0068862_101793761 3300005844 Bacteria 623
41 Ga0068871_101976150 3300006358 Bacteria 555
42 Ga0075430_100884857 3300006846 Bacteria 736
43 Ga0075434_102113965 3300006871 Bacteria 567
44 Ga0097620_100535606 3300006931 Bacteria 1266
45 Ga0097620_102590279 3300006931 Bacteria 558
46 Ga0105240_10079304 3300009093 Bacteria 4041
47 Ga0111539_10789842 3300009094 Bacteria 1105
48 Ga0105245_10040965 3300009098 Bacteria 4128
49 Ga0105243_11381945 3300009148 Bacteria 724
50 Ga0105248_10258425 3300009177 Bacteria 1961
51 Ga0105248_11705357 3300009177 Bacteria 714
52 Ga0105249_10164208 3300009553 Bacteria 2148
53 Ga0105249_12729139 3300009553 Bacteria 566
54 Ga0157373_10927060 3300013100 Bacteria 647
55 Ga0157370_10109568 3300013104 Bacteria 2581
56 Ga0157372_10102299 3300013307 Bacteria 3272
57 Ga0157375_10628646 3300013308 Bacteria 1231
58 Ga0157375_10980455 3300013308 Bacteria 986
59 Ga0157375_12364574 3300013308 Bacteria 634
60 Ga0163163_10077733 3300014325 Bacteria 3314
61 Ga0163163_10121166 3300014325 Bacteria 2650
62 Ga0163163_13091555 3300014325 Bacteria 519
63 Ga0157380_12192036 3300014326 Bacteria 616
64 Ga0157379_11978435 3300014968 Unclassified 576
65 Ga0213876_10033115 3300021384 Bacteria 2724
66 Ga0207682_10002710 3300025893 Bacteria 7872
67 Ga0207682_10164918 3300025893 Bacteria 1006
68 Ga0207680_10286412 3300025903 Bacteria 1146
69 Ga0207645_10329623 3300025907 Unclassified 1019
70 Ga0207707_11468110 3300025912 Bacteria 541
71 Ga0207695_10012625 3300025913 Bacteria 10121
72 Ga0207660_10166438 3300025917 Bacteria 1704
73 Ga0207657_10002315 3300025919 Bacteria 20657
74 Ga0207681_10069181 3300025923 Bacteria 2455
75 Ga0207687_10010460 3300025927 Bacteria 6059
76 Ga0207687_10204566 3300025927 Bacteria 1545
77 Ga0207644_10519183 3300025931 Bacteria 984
78 Ga0207690_10000001 3300025932 Bacteria 807539
79 Ga0207709_10163585 3300025935 Bacteria 1554
80 Ga0207691_10333409 3300025940 Bacteria 1300
81 Ga0207711_10115505 3300025941 Bacteria 2392
82 Ga0207711_11306648 3300025941 Bacteria 667
83 Ga0207689_10224785 3300025942 Bacteria 1551
84 Ga0207689_10975548 3300025942 Bacteria 715
85 Ga0207661_10466035 3300025944 Bacteria 1152
86 Ga0207679_10172105 3300025945 Bacteria 1784
87 Ga0207667_10043591 3300025949 Bacteria 4761
88 Ga0207712_10287485 3300025961 Bacteria 1344
89 Ga0207712_11691026 3300025961 Bacteria 567
90 Ga0207668_10000001 3300025972 Bacteria 266091
91 Ga0207677_10000176 3300026023 Bacteria 50717
92 Ga0207703_11749834 3300026035 Bacteria 598
93 Ga0207708_10258603 3300026075 Bacteria 1405
94 Ga0207641_10213594 3300026088 Bacteria 1785
95 Ga0207641_10321638 3300026088 Bacteria 1467
96 Ga0207676_10192205 3300026095 Bacteria 1797
97 Ga0207676_12443031 3300026095 Bacteria 519
98 Ga0207675_100227743 3300026118 Bacteria 1797
99 Ga0207698_10726301 3300026142 Bacteria 990
100 Ga0268266_10001199 3300028379 Bacteria 31991
101 Ga0268266_10033288 3300028379 Bacteria 4382
102 Ga0268265_10294895 3300028380 Bacteria 1457
103 Ga0307517_10312357 3300028786 Bacteria 875
104 Ga0307513_10023703 3300031456 Bacteria 7163
105 Ga0307513_10572686 3300031456 Bacteria 840
106 Ga0307408_100091813 3300031548 Bacteria 2294
107 Ga0307408_101395427 3300031548 Bacteria 659
108 Ga0307405_10519643 3300031731 Bacteria 958
109 Ga0307413_10072189 3300031824 Bacteria 2178
110 Ga0307413_10238046 3300031824 Bacteria 1342
111 Ga0307413_11124964 3300031824 Unclassified 679
112 Ga0307410_10149328 3300031852 Unclassified 1738
113 Ga0307410_12024195 3300031852 Bacteria 514
114 Ga0307406_10100637 3300031901 Bacteria 1968
115 Ga0307409_100590633 3300031995 Bacteria 1096
116 Ga0307409_101937621 3300031995 Bacteria 619
117 Ga0307416_100202937 3300032002 Bacteria 1883
118 Ga0307416_100572925 3300032002 Bacteria 1205
119 Ga0307416_101299828 3300032002 Bacteria 833
120 Ga0307416_102033129 3300032002 Bacteria 677
121 Ga0307414_10043471 3300032004 Bacteria 3061
122 Ga0307414_10815610 3300032004 Bacteria 852
123 Ga0307411_10401057 3300032005 Bacteria 1134
124 Ga0307411_10864566 3300032005 Bacteria 801
125 Ga0307415_101447697 3300032126 Bacteria 656
126 Ga0373946_0014801 3300035171 Bacteria 2947
127 Ga0373927_0000609 3300035695 Bacteria 27211
128 Ga0373947_0189301 3300035725 Bacteria 1342
129 Ga0373925_0000341 3300037068 Bacteria 48502
130 Ga0395899_0000004 3300037312 Bacteria 874267
131 Ga0395899_0000485 3300037312 Bacteria 44590
132 Ga0395899_0100114 3300037312 Bacteria 2093
133 Ga0395900_0000072 3300037418 Bacteria 187428
134 Ga0395900_0144121 3300037418 Bacteria 2437
135 Ga0395900_0441293 3300037418 Bacteria 1259
136 Ga0395898_0275666 3300037466 Bacteria 1604
137 Ga0395898_0771174 3300037466 Bacteria 902
138 Ga0395898_0858910 3300037466 Bacteria 846
139 Ga0395905_0012874 3300037471 Bacteria 8041
140 Ga0395905_0015745 3300037471 Bacteria 7184
141 Ga0395905_0036483 3300037471 Bacteria 4617
142 Ga0395905_0079141 3300037471 Unclassified 3081
143 Ga0395905_0152413 3300037471 Bacteria 2174
144 Ga0395901_0000052 3300038443 Bacteria 165888
145 Ga0395901_0903797 3300038443 Bacteria 865
146 Ga0436365_0550463 3300039437 Bacteria 2979
147 Ga0436365_0925255 3300039437 Bacteria 1066
148 Ga0466970_0321502 3300044765 Bacteria 875
149 Ga0466959_0831856 3300045049 Bacteria 617
150 Ga0495596_0397104 3300046500 Bacteria 537
151 Ga0495642_0008820 3300046528 Bacteria 3856
152 Ga0495670_0087065 3300046691 Unclassified 1596
153 Ga0495686_0343791 3300047472 Bacteria 813
154 Ga0496102_0758947 3300048905 Bacteria 893
155 Ga0496104_1200285 3300048907 Bacteria 662
156 Ga0496109_1015164 3300048912 Bacteria 767
157 Ga0496112_0384258 3300048915 Bacteria 1345
158 Ga0496114_0753750 3300048917 Bacteria 851
159 Ga0501320_039258 3300049536 Bacteria 615
160 Ga0501032_0884099 3300049569 Bacteria 563
161 Ga0501034_0038567 3300049571 Bacteria 4837
162 Ga0501034_0169499 3300049571 Bacteria 2151
163 Ga0501047_0005586 3300049581 Bacteria 11841
164 Ga0501047_0010818 3300049581 Bacteria 8624
165 Ga0501047_0126040 3300049581 Bacteria 2441
166 Ga0501069_0033629 3300049585 Bacteria 2824
167 Ga0501070_0869531 3300049586 Bacteria 704
168 Ga0501071_0294901 3300049587 Unclassified 1229
169 Ga0501080_0176501 3300049742 Bacteria 1968
170 Ga0501080_0989734 3300049742 Bacteria 730
171 Ga0501083_0397184 3300049744 Bacteria 897
172 Ga0501035_0059639 3300049822 Bacteria 3399
173 Ga0501035_0517377 3300049822 Bacteria 981
174 Ga0501044_0821540 3300049823 Bacteria 808
175 nmdc:mga0qj67_1356234_c1 3300050509 Bacteria 550
176 nmdc:mga0n895_165265_c1 3300050512 Bacteria 2245
177 Ga0500610_0221933 3300053079 Bacteria 894
178 Ga0500556_0109230 3300053104 Bacteria 1071
179 Ga0500562_007690 3300053108 Bacteria 2718
180 Ga0501082_0314338 3300060353 Bacteria 1364
181 Ga0070669_100044553
182 Ga0070683_100269490
183 Ga0070670_100843884
184 Ga0070677_10001946
185 Ga0070677_10374131
186 Ga0068869_100105248
187 Ga0068869_101793250
188 Ga0070680_100135544
189 Ga0068868_100000122
190 Ga0068868_100697563
191 Ga0070660_100000521
192 Ga0070668_100661985
193 Ga0070675_100423864
194 Ga0070675_100507903
195 Ga0070673_100318969
196 Ga0070673_101391004
197 Ga0070659_100000032
198 Ga0070667_101955124
199 Ga0070714_101743162
200 Ga0070662_100693581
201 Ga0070681_11186769
202 Ga0068867_100896787
203 Ga0070684_100209304
204 Ga0070672_100240614
205 Ga0070686_100000526
206 Ga0070686_101080078
207 Ga0070665_100000616
208 Ga0070665_100075487
209 Ga0068855_100081094
210 Ga0068854_100281318
211 Ga0070702_101032096
212 Ga0068852_101470196
213 Ga0068859_100535631
214 Ga0068864_100405234
215 Ga0068864_101983945
216 Ga0068863_100323829
217 Ga0068863_100698930
218 Ga0068858_101168911
219 Ga0068860_102458077
220 Ga0068862_101793761
221 Ga0068871_101976150
222 Ga0075430_100884857
223 Ga0075434_102113965
224 Ga0097620_100535606
225 Ga0097620_102590279
226 Ga0105240_10079304
227 Ga0111539_10789842
228 Ga0105245_10040965
229 Ga0105243_11381945
230 Ga0105248_10258425
231 Ga0105248_11705357
232 Ga0105249_10164208
233 Ga0105249_12729139
234 Ga0157373_10927060
235 Ga0157370_10109568
236 Ga0157372_10102299
237 Ga0157375_10628646
238 Ga0157375_10980455
239 Ga0157375_12364574
240 Ga0163163_10077733
241 Ga0163163_10121166
242 Ga0163163_13091555
243 Ga0157380_12192036
244 Ga0157379_11978435
245 Ga0213876_10033115
246 Ga0207682_10002710
247 Ga0207682_10164918
248 Ga0207680_10286412
249 Ga0207645_10329623
250 Ga0207707_11468110
251 Ga0207695_10012625
252 Ga0207660_10166438
253 Ga0207657_10002315
254 Ga0207681_10069181
255 Ga0207687_10010460
256 Ga0207687_10204566
257 Ga0207644_10519183
258 Ga0207690_10000001
259 Ga0207709_10163585
260 Ga0207691_10333409
261 Ga0207711_10115505
262 Ga0207711_11306648
263 Ga0207689_10224785
264 Ga0207689_10975548
265 Ga0207661_10466035
266 Ga0207679_10172105
267 Ga0207667_10043591
268 Ga0207712_10287485
269 Ga0207712_11691026
270 Ga0207668_10000001
271 Ga0207677_10000176
272 Ga0207703_11749834
273 Ga0207708_10258603
274 Ga0207641_10213594
275 Ga0207641_10321638
276 Ga0207676_10192205
277 Ga0207676_12443031
278 Ga0207675_100227743
279 Ga0207698_10726301
280 Ga0268266_10001199
281 Ga0268266_10033288
282 Ga0268265_10294895
283 Ga0307517_10312357
284 Ga0307513_10023703
285 Ga0307513_10572686
286 Ga0307408_100091813
287 Ga0307408_101395427
288 Ga0307405_10519643
289 Ga0307413_10072189
290 Ga0307413_10238046
291 Ga0307413_11124964
292 Ga0307410_10149328
293 Ga0307410_12024195
294 Ga0307406_10100637
295 Ga0307409_100590633
296 Ga0307409_101937621
297 Ga0307416_100202937
298 Ga0307416_100572925
299 Ga0307416_101299828
300 Ga0307416_102033129
301 Ga0307414_10043471
302 Ga0307414_10815610
303 Ga0307411_10401057
304 Ga0307411_10864566
305 Ga0307415_101447697
306 Ga0373946_0014801
307 Ga0373927_0000609
308 Ga0373947_0189301
309 Ga0373925_0000341
310 Ga0395899_0000004
311 Ga0395899_0000485
312 Ga0395899_0100114
313 Ga0395900_0000072
314 Ga0395900_0144121
315 Ga0395900_0441293
316 Ga0395898_0275666
317 Ga0395898_0771174
318 Ga0395898_0858910
319 Ga0395905_0012874
320 Ga0395905_0015745
321 Ga0395905_0036483
322 Ga0395905_0079141
323 Ga0395905_0152413
324 Ga0395901_0000052
325 Ga0395901_0903797
326 Ga0436365_0550463
327 Ga0436365_0925255
328 Ga0466970_0321502
329 Ga0466959_0831856
330 Ga0495596_0397104
331 Ga0495642_0008820
332 Ga0495670_0087065
333 Ga0495686_0343791
334 Ga0496102_0758947
335 Ga0496104_1200285
336 Ga0496109_1015164
337 Ga0496112_0384258
338 Ga0496114_0753750
339 Ga0501320_039258
340 Ga0501032_0884099
341 Ga0501034_0038567
342 Ga0501034_0169499
343 Ga0501047_0005586
344 Ga0501047_0010818
345 Ga0501047_0126040
346 Ga0501069_0033629
347 Ga0501070_0869531
348 Ga0501071_0294901
349 Ga0501080_0176501
350 Ga0501080_0989734
351 Ga0501083_0397184
352 Ga0501035_0059639
353 Ga0501035_0517377
354 Ga0501044_0821540
355 nmdc:mga0qj67_1356234_c1
356 nmdc:mga0n895_165265_c1
357 Ga0500610_0221933
358 Ga0500556_0109230
359 Ga0500562_007690
360 Ga0501082_0314338

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07027

DUF1318

Protein of unknown function (DUF1318)

25

117

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nc5-assembly2.cif.gz_B cyp134a1 structure with an open substrate binding loop 0.8395 52 87
3jb9-assembly1.cif.gz_A cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution 0.8188 50 83
6bk8-assembly1.cif.gz_A s. cerevisiae spliceosomal post-catalytic p complex 0.7398 50 90
1s4k-assembly1.cif.gz_B putative cytoplasmic protein from salmonella typhimurium 0.6281 51 93
7uck-assembly1.cif.gz_TT 80s translation initiation complex with ac4c(-1) mrna and harringtonine 0.6202 39 71
ID Description Score Start End Superfamily
af_Q00975_1460_1582_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.8739 52 78 1.20.120.350
af_Q07652_1419_1542_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.8415 52 80 1.20.120.350
3nc5B00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.8395 52 87 1.10.630.10
af_Q02294_1462_1582_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.8323 52 84 1.20.120.350
af_Q9N4P9_31_241_3.30.230.70 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.685 47 75 3.30.230.70
ID Description Score Start End GO Terms
AF-A0A7C7SAB8-F1-model_v4 deleted 0.9439 34 77
AF-A0A3D4QIV6-F1-model_v4 DUF1318 domain-containing protein 0.9191 31 77
AF-A0A7V8ZGB8-F1-model_v4 DUF1318 domain-containing protein 0.9167 32 77
AF-A0A1Z7YMJ9-F1-model_v4 DUF1318 domain-containing protein 0.8947 34 77
AF-A0A080J0U6-F1-model_v4 deleted 0.8831 31 77

Map