F274910

General Info

Members Datasets Scaffolds Average Seq Length
180 110 179 556

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10002007|Ga0065707_100020073
Length 605
Sequence MKAKHVFTWSITTLLIITLFGAVPAAAAPQDAPSRAFKAPKPHFSDNVAFDVSPALRDLAKKAPKPWNGPVPDEIRPDRGRSVMDNGFSSDGAIQQTSTNRNVTAASIPSTTANFEGLRNEDNVTAGLFRVNPPDPNGDVGLNHYVEMINLVFGVYSKTGTLLLGPVDTGTLWSDFPIEDCTDPSGDPIVLYDQFVDRWLLSQFTTRGMNPDGSYNGLPFYNCVAISQTGDPTGAYYRYAFITSMPGTTSTFFPDYPKYGVWTDSYVLTSRDFGSQDEYGISVYALEKNKMVNGQPDARAVHFFLDGNDPAILPLVGDGLLPADVDGKQKPKTDTAIPIVGTQDDGFPYGATFDALNIWDLSVKWHSTPTASLTLNTQLPVASFDSRFPCGVTPGFPPPLQPTGRDCLPQPGITNGSQYLDILSYRQRPTWRLAYRNFKDYETLVTNQSVEALPGVAGVRWYEIRRVNGSYSLYQQGTYAPNDGVHRWMGSVTQDKKGNMALGYSVVNGVDVYPGIRYTGRLADDPLGQMNLGEGVIINGTGVQTTTNSRWGDYTSMNIDPVDDCTFWYVNEYYAVSGVPLPAPPGTDTRPWQTRIASFKLPGCN

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2643221695 Lysobacter sp. Root494 Isolate Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
74 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
101 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
104 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
109 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
110 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.56
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 1.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5973844 2162886012 Bacteria 2292
2 rootH2_10183569 3300003320 Bacteria 2317
3 Ga0065704_10100215 3300005289 Unclassified 2282
4 Ga0065715_10119301 3300005293 Bacteria 2279
5 Ga0065707_10002007 3300005295 Bacteria 5552
6 Ga0070680_100047907 3300005336 Bacteria 3481
7 Ga0068868_100075493 3300005338 Bacteria 2694
8 Ga0070669_100036050 3300005353 Bacteria 3583
9 Ga0070674_100006073 3300005356 Bacteria 7024
10 Ga0070714_100018290 3300005435 Bacteria 5690
11 Ga0070713_100027500 3300005436 Bacteria 4478
12 Ga0070710_10042128 3300005437 Bacteria 2523
13 Ga0070710_10044479 3300005437 Bacteria 2464
14 Ga0070711_100035197 3300005439 Bacteria 3346
15 Ga0070711_100041702 3300005439 Bacteria 3101
16 Ga0070708_100003016 3300005445 Bacteria 13071
17 Ga0070708_100009964 3300005445 Bacteria 7684
18 Ga0070708_100046712 3300005445 Bacteria 3821
19 Ga0070662_100035314 3300005457 Bacteria 3530
20 Ga0068867_100122255 3300005459 Bacteria 2013
21 Ga0070706_100011735 3300005467 Bacteria 8129
22 Ga0070707_100005032 3300005468 Bacteria 12392
23 Ga0070707_100006455 3300005468 Bacteria 10900
24 Ga0070707_100009785 3300005468 Bacteria 8914
25 Ga0070707_100061761 3300005468 Bacteria 3594
26 Ga0070707_100144083 3300005468 Bacteria 2319
27 Ga0070698_100009387 3300005471 Bacteria 10490
28 Ga0070698_100043434 3300005471 Unclassified 4608
29 Ga0070699_100006489 3300005518 Bacteria 10185
30 Ga0070697_100001895 3300005536 Bacteria 15983
31 Ga0070697_100063102 3300005536 Bacteria 3025
32 Ga0070697_100120271 3300005536 Unclassified 2196
33 Ga0070672_100042612 3300005543 Bacteria 3495
34 Ga0068856_100149936 3300005614 Bacteria 2341
35 Ga0068859_100051477 3300005617 Bacteria 4140
36 Ga0068861_100059458 3300005719 Bacteria 2926
37 Ga0068870_10027765 3300005840 Bacteria 2835
38 Ga0068863_100069960 3300005841 Bacteria 3318
39 Ga0068862_100093924 3300005844 Bacteria 2616
40 Ga0081455_10000287 3300005937 Bacteria 66731
41 Ga0081455_10028969 3300005937 Bacteria 5054
42 Ga0081540_1016663 3300005983 Bacteria 4585
43 Ga0081539_10002884 3300005985 Bacteria 22789
44 Ga0070717_10074939 3300006028 Unclassified 2830
45 Ga0070716_100000593 3300006173 Bacteria 15253
46 Ga0070712_100002455 3300006175 Bacteria 11428
47 Ga0070712_100019140 3300006175 Bacteria 4459
48 Ga0070712_100038579 3300006175 Bacteria 3265
49 Ga0075428_100002527 3300006844 Bacteria 19892
50 Ga0075430_100001464 3300006846 Bacteria 19207
51 Ga0075431_100005258 3300006847 Bacteria 12749
52 Ga0075431_100020088 3300006847 Bacteria 6821
53 Ga0075431_100064086 3300006847 Bacteria 3794
54 Ga0075431_100075840 3300006847 Bacteria 3470
55 Ga0075433_10004156 3300006852 Bacteria 11235
56 Ga0075433_10017254 3300006852 Bacteria 5975
57 Ga0075433_10017759 3300006852 Bacteria 5902
58 Ga0075434_100000483 3300006871 Bacteria 29908
59 Ga0075434_100007444 3300006871 Bacteria 10125
60 Ga0075434_100027437 3300006871 Bacteria 5590
61 Ga0075434_100218185 3300006871 Unclassified 1927
62 Ga0075429_100009031 3300006880 Bacteria 8659
63 Ga0097620_100051476 3300006931 Bacteria 4140
64 Ga0075435_100102915 3300007076 Unclassified 2368
65 Ga0105240_10152768 3300009093 Bacteria 2748
66 Ga0105245_10033955 3300009098 Bacteria 4522
67 Ga0114129_10010744 3300009147 Bacteria 13049
68 Ga0114129_10022526 3300009147 Bacteria 8939
69 Ga0114129_10181217 3300009147 Bacteria 2866
70 Ga0105249_10016684 3300009553 Bacteria 6518
71 Ga0105249_10040493 3300009553 Unclassified 4232
72 Ga0163162_10082332 3300013306 Bacteria 3290
73 Ga0157375_10028826 3300013308 Bacteria 5211
74 Ga0207645_10029252 3300025907 Bacteria 3553
75 Ga0207643_10030031 3300025908 Bacteria 3024
76 Ga0207684_10003036 3300025910 Bacteria 16639
77 Ga0207684_10064816 3300025910 Bacteria 3102
78 Ga0207693_10000950 3300025915 Bacteria 25981
79 Ga0207693_10006958 3300025915 Bacteria 9343
80 Ga0207693_10082138 3300025915 Bacteria 2523
81 Ga0207663_10027265 3300025916 Bacteria 3326
82 Ga0207663_10038802 3300025916 Bacteria 2882
83 Ga0207646_10018077 3300025922 Bacteria 6582
84 Ga0207646_10041022 3300025922 Unclassified 4162
85 Ga0207687_10040241 3300025927 Bacteria 3203
86 Ga0207706_10004202 3300025933 Bacteria 13558
87 Ga0207665_10000552 3300025939 Bacteria 25226
88 Ga0207691_10020233 3300025940 Bacteria 6294
89 Ga0207712_10011680 3300025961 Bacteria 5599
90 Ga0207675_100005176 3300026118 Bacteria 12553
91 Ga0210002_1000639 3300027617 Bacteria 4730
92 Ga0209983_1006818 3300027665 Bacteria 2343
93 Ga0209971_1002103 3300027682 Bacteria 4846
94 Ga0209998_10004937 3300027717 Bacteria 2805
95 Ga0209974_10000535 3300027876 Bacteria 12695
96 Ga0207428_10005447 3300027907 Bacteria 11871
97 Ga0316575_10006379 3300031665 Unclassified 4238
98 Ga0307405_10001003 3300031731 Bacteria 11385
99 Ga0307406_10010718 3300031901 Bacteria 5178
100 Ga0307416_100002558 3300032002 Bacteria 10494
101 Ga0307416_100022811 3300032002 Bacteria 4528
102 Ga0307415_100000316 3300032126 Bacteria 20972
103 Ga0373943_0025027 3300035170 Bacteria 2787
104 Ga0316574_0032336 3300035398 Bacteria 3179
105 Ga0373947_0007602 3300035725 Bacteria 6272
106 Ga0316582_0037770 3300036647 Unclassified 2997
107 Ga0373925_0007517 3300037068 Bacteria 7943
108 Ga0395899_0012852 3300037312 Bacteria 6412
109 Ga0395899_0013170 3300037312 Bacteria 6325
110 Ga0395899_0020985 3300037312 Bacteria 4954
111 Ga0395900_0008563 3300037418 Bacteria 10517
112 Ga0395900_0008705 3300037418 Bacteria 10426
113 Ga0395900_0026358 3300037418 Bacteria 5953
114 Ga0395898_0002473 3300037466 Bacteria 21789
115 Ga0395898_0004274 3300037466 Bacteria 15666
116 Ga0395898_0045739 3300037466 Bacteria 4301
117 Ga0395898_0061978 3300037466 Bacteria 3633
118 Ga0395898_0099449 3300037466 Bacteria 2793
119 Ga0395905_0003589 3300037471 Bacteria 16508
120 Ga0395905_0007410 3300037471 Bacteria 10908
121 Ga0395905_0008692 3300037471 Bacteria 9997
122 Ga0395905_0055740 3300037471 Bacteria 3699
123 Ga0395901_0001612 3300038443 Bacteria 23362
124 Ga0395901_0004594 3300038443 Bacteria 13940
125 Ga0395901_0006494 3300038443 Bacteria 11834
126 Ga0395901_0023102 3300038443 Bacteria 6374
127 Ga0395901_0026932 3300038443 Bacteria 5903
128 Ga0395901_0030336 3300038443 Bacteria 5570
129 Ga0395901_0063340 3300038443 Bacteria 3848
130 Ga0395901_0174841 3300038443 Bacteria 2252
131 Ga0395901_0260768 3300038443 Bacteria 1804
132 Ga0439448_0006995 3300042005 Bacteria 3255
133 Ga0451576_0013130 3300045051 Bacteria 9274
134 Ga0495629_0009490 3300046459 Bacteria 7114
135 Ga0495580_0018525 3300046472 Bacteria 5182
136 Ga0495580_0027668 3300046472 Bacteria 4124
137 Ga0495580_0095378 3300046472 Bacteria 2069
138 Ga0495664_0020740 3300046477 Bacteria 3793
139 Ga0495665_0020541 3300046531 Unclassified 3546
140 Ga0495640_0072493 3300046533 Bacteria 2308
141 Ga0495658_0056234 3300046683 Bacteria 2243
142 Ga0495613_0139917 3300046689 Bacteria 1730
143 Ga0495581_0083198 3300047315 Bacteria 1854
144 Ga0495674_0089889 3300047319 Bacteria 2625
145 Ga0496105_0011069 3300048908 Bacteria 7111
146 Ga0496105_0056074 3300048908 Bacteria 3253
147 Ga0496108_0010037 3300048911 Bacteria 7679
148 Ga0496109_0051894 3300048912 Bacteria 3736
149 Ga0496110_0112797 3300048913 Bacteria 2444
150 Ga0496111_0019988 3300048914 Bacteria 4659
151 Ga0496111_0039636 3300048914 Bacteria 3379
152 Ga0496111_0076596 3300048914 Bacteria 2438
153 Ga0496112_0000775 3300048915 Bacteria 22490
154 Ga0496112_0001515 3300048915 Bacteria 17883
155 Ga0501067_0063985 3300049583 Bacteria 2037
156 Ga0501077_0001518 3300049593 Bacteria 13992
157 nmdc:mga05p37_38609_c1 3300050507 Bacteria 5858
158 nmdc:mga09592_62165_c1 3300050508 Bacteria 3159
159 nmdc:mga09592_7649_c1 3300050508 Bacteria 8786
160 nmdc:mga0qj67_112285_c1 3300050509 Bacteria 2200
161 nmdc:mga0qj67_60428_c1 3300050509 Bacteria 3008
162 nmdc:mga0qj67_7284_c1 3300050509 Bacteria 8175
163 nmdc:mga0qj67_97543_c1 3300050509 Bacteria 2367
164 nmdc:mga06r32_2783_c1 3300050510 Bacteria 15664
165 nmdc:mga06r32_39501_c1 3300050510 Bacteria 4478
166 nmdc:mga06r32_491_c2 3300050510 Bacteria 17061
167 nmdc:mga06r32_9015_c1 3300050510 Bacteria 8989
168 nmdc:mga08y16_9536_c1 3300050511 Bacteria 10188
169 nmdc:mga0n895_214120_c1 3300050512 Unclassified 1956
170 nmdc:mga0n895_26798_c1 3300050512 Bacteria 5466
171 nmdc:mga0n895_7535_c1 3300050512 Bacteria 9351
172 nmdc:mga0n895_8381_c1 3300050512 Bacteria 8949
173 nmdc:mga0n895_96481_c1 3300050512 Bacteria 2962
174 nmdc:mga0rr50_13279_c1 3300050513 Bacteria 5357
175 nmdc:mga0rr50_49705_c1 3300050513 Bacteria 3105
176 nmdc:mga0a205_27359_c1 3300050515 Bacteria 5447
177 nmdc:mga0a205_27740_c1 3300050515 Bacteria 5408
178 nmdc:mga0a205_450_c1 3300050515 Bacteria 30909
179 Ga0495619_0080093 3300053085 Bacteria 2198

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10022526 Ga0114129_100225263 419
2 3300037312 Ga0395899_0012852 Ga0395899_0012852_1728_3221 424
3 3300037418 Ga0395900_0008705 Ga0395900_0008705_5781_7274 424
4 3300037466 Ga0395898_0002473 Ga0395898_0002473_19345_20838 424
5 3300037471 Ga0395905_0008692 Ga0395905_0008692_2952_4445 424
6 3300038443 Ga0395901_0001612 Ga0395901_0001612_1646_3139 424
7 3300046689 Ga0495613_0139917 Ga0495613_0139917_244_1710 432
8 3300047315 Ga0495581_0083198 Ga0495581_0083198_356_1822 432
9 3300053085 Ga0495619_0080093 Ga0495619_0080093_72_1550 446
10 3300035170 Ga0373943_0025027 Ga0373943_0025027_684_2207 448
11 3300035725 Ga0373947_0007602 Ga0373947_0007602_4241_5764 448
12 3300037068 Ga0373925_0007517 Ga0373925_0007517_2435_3958 448
13 3300046472 Ga0495580_0027668 Ga0495580_0027668_2161_3684 448
14 3300046531 Ga0495665_0020541 Ga0495665_0020541_1390_2913 448
15 3300046683 Ga0495658_0056234 Ga0495658_0056234_333_1856 448
16 3300038443 Ga0395901_0026932 Ga0395901_0026932_3075_4655 451
17 3300037471 Ga0395905_0055740 Ga0395905_0055740_1380_3086 455
18 3300025916 Ga0207663_10027265 Ga0207663_100272654 456
19 3300037312 Ga0395899_0013170 Ga0395899_0013170_2441_4021 457
20 3300037466 Ga0395898_0045739 Ga0395898_0045739_1676_3256 457
21 3300038443 Ga0395901_0004594 Ga0395901_0004594_2161_3741 457
22 3300048915 Ga0496112_0000775 Ga0496112_0000775_20819_22429 457
23 3300027907 Ga0207428_10005447 Ga0207428_100054478 461
24 3300050511 nmdc:mga08y16_9536_c1 nmdc:mga08y16_9536_c1_6004_7788 461
25 3300050512 nmdc:mga0n895_7535_c1 nmdc:mga0n895_7535_c1_6080_7864 461
26 3300046459 Ga0495629_0009490 Ga0495629_0009490_3765_5288 463
27 3300005445 Ga0070708_100046712 Ga0070708_1000467124 467
28 3300005468 Ga0070707_100061761 Ga0070707_1000617614 467
29 3300027717 Ga0209998_10004937 Ga0209998_100049372 467
30 3300005985 Ga0081539_10002884 Ga0081539_1000288419 468
31 3300025915 Ga0207693_10006958 Ga0207693_100069582 468
32 3300013308 Ga0157375_10028826 Ga0157375_100288261 473
33 3300048914 Ga0496111_0076596 Ga0496111_0076596_249_1919 473
34 3300048908 Ga0496105_0011069 Ga0496105_0011069_1158_2909 474
35 3300048911 Ga0496108_0010037 Ga0496108_0010037_3356_5107 474
36 3300048912 Ga0496109_0051894 Ga0496109_0051894_592_2343 474
37 3300048913 Ga0496110_0112797 Ga0496110_0112797_411_2162 474
38 3300048914 Ga0496111_0019988 Ga0496111_0019988_48_1799 474
39 3300048915 Ga0496112_0001515 Ga0496112_0001515_6431_8182 474
40 3300031731 Ga0307405_10001003 Ga0307405_100010038 478
41 3300031901 Ga0307406_10010718 Ga0307406_100107182 478
42 3300032002 Ga0307416_100002558 Ga0307416_1000025585 478
43 3300032126 Ga0307415_100000316 Ga0307415_10000031615 478
44 3300046477 Ga0495664_0020740 Ga0495664_0020740_1760_3511 478
45 3300050509 nmdc:mga0qj67_112285_c1 nmdc:mga0qj67_112285_c1_238_1920 478
46 3300005983 Ga0081540_1016663 Ga0081540_10166633 480
47 3300036647 Ga0316582_0037770 Ga0316582_0037770_763_2538 480
48 3300046533 Ga0495640_0072493 Ga0495640_0072493_203_1954 482
49 3300047319 Ga0495674_0089889 Ga0495674_0089889_401_2152 482
50 3300031665 Ga0316575_10006379 Ga0316575_100063794 483
51 3300037466 Ga0395898_0099449 Ga0395898_0099449_772_2490 484
52 3300038443 Ga0395901_0023102 Ga0395901_0023102_4379_6097 484
53 3300035398 Ga0316574_0032336 Ga0316574_0032336_844_2619 485
54 3300005435 Ga0070714_100018290 Ga0070714_1000182902 486
55 3300005437 Ga0070710_10042128 Ga0070710_100421282 486
56 3300005439 Ga0070711_100035197 Ga0070711_1000351972 486
57 3300006175 Ga0070712_100038579 Ga0070712_1000385791 486
58 3300025915 Ga0207693_10082138 Ga0207693_100821381 486
59 3300025916 Ga0207663_10038802 Ga0207663_100388024 486
60 3300006871 Ga0075434_100218185 Ga0075434_1002181851 487
61 3300042005 Ga0439448_0006995 Ga0439448_0006995_1453_3228 487
62 3300050512 nmdc:mga0n895_214120_c1 nmdc:mga0n895_214120_c1_181_1917 487
63 3300046472 Ga0495580_0095378 Ga0495580_0095378_141_1832 488
64 3300049583 Ga0501067_0063985 Ga0501067_0063985_226_1986 489
65 3300005471 Ga0070698_100043434 Ga0070698_1000434341 494
66 3300038443 Ga0395901_0260768 Ga0395901_0260768_14_1762 494
67 3300005445 Ga0070708_100003016 Ga0070708_1000030168 495
68 3300009553 Ga0105249_10040493 Ga0105249_100404935 495
69 3300037418 Ga0395900_0008563 Ga0395900_0008563_1462_3219 495
70 3300037466 Ga0395898_0004274 Ga0395898_0004274_9203_10960 495
71 3300037471 Ga0395905_0007410 Ga0395905_0007410_7051_8808 495
72 3300038443 Ga0395901_0063340 Ga0395901_0063340_76_1833 495
73 3300005338 Ga0068868_100075493 Ga0068868_1000754931 496
74 3300009093 Ga0105240_10152768 Ga0105240_101527683 496
75 3300009098 Ga0105245_10033955 Ga0105245_100339552 496
76 3300009553 Ga0105249_10016684 Ga0105249_100166841 496
77 3300013306 Ga0163162_10082332 Ga0163162_100823325 496
78 3300025927 Ga0207687_10040241 Ga0207687_100402413 496
79 3300025961 Ga0207712_10011680 Ga0207712_100116802 496
80 3300005356 Ga0070674_100006073 Ga0070674_1000060736 499
81 3300005459 Ga0068867_100122255 Ga0068867_1001222551 499
82 3300006844 Ga0075428_100002527 Ga0075428_10000252718 499
83 3300005614 Ga0068856_100149936 Ga0068856_1001499361 500
84 3300006175 Ga0070712_100019140 Ga0070712_1000191404 500
85 3300006847 Ga0075431_100020088 Ga0075431_1000200881 500
86 3300038443 Ga0395901_0174841 Ga0395901_0174841_472_2205 500
87 3300048914 Ga0496111_0039636 Ga0496111_0039636_1569_3293 500
88 3300050510 nmdc:mga06r32_491_c2 nmdc:mga06r32_491_c2_1913_3589 500
89 3300005445 Ga0070708_100009964 Ga0070708_1000099644 501
90 3300005468 Ga0070707_100005032 Ga0070707_1000050326 501
91 3300005471 Ga0070698_100009387 Ga0070698_1000093878 501
92 3300005518 Ga0070699_100006489 Ga0070699_1000064899 501
93 3300005536 Ga0070697_100001895 Ga0070697_10000189516 501
94 3300005536 Ga0070697_100063102 Ga0070697_1000631021 501
95 3300006028 Ga0070717_10074939 Ga0070717_100749391 501
96 3300025910 Ga0207684_10003036 Ga0207684_1000303617 501
97 3300025922 Ga0207646_10018077 Ga0207646_100180773 501
98 3300046472 Ga0495580_0018525 Ga0495580_0018525_253_1956 501
99 3300005536 Ga0070697_100120271 Ga0070697_1001202712 503
100 3300005937 Ga0081455_10028969 Ga0081455_100289692 503
101 3300032002 Ga0307416_100022811 Ga0307416_1000228113 503
102 3300037312 Ga0395899_0020985 Ga0395899_0020985_3080_4786 503
103 3300037471 Ga0395905_0003589 Ga0395905_0003589_11961_13667 503
104 3300038443 Ga0395901_0030336 Ga0395901_0030336_1180_2886 503
105 3300005437 Ga0070710_10044479 Ga0070710_100444791 506
106 3300005439 Ga0070711_100041702 Ga0070711_1000417022 506
107 3300005468 Ga0070707_100006455 Ga0070707_1000064555 506
108 3300005468 Ga0070707_100009785 Ga0070707_1000097856 506
109 3300005468 Ga0070707_100144083 Ga0070707_1001440832 506
110 3300006173 Ga0070716_100000593 Ga0070716_10000059312 506
111 3300006175 Ga0070712_100002455 Ga0070712_1000024556 506
112 3300006847 Ga0075431_100075840 Ga0075431_1000758402 506
113 3300025915 Ga0207693_10000950 Ga0207693_1000095020 506
114 3300025939 Ga0207665_10000552 Ga0207665_100005526 506
115 3300037466 Ga0395898_0061978 Ga0395898_0061978_946_2721 506
116 3300038443 Ga0395901_0006494 Ga0395901_0006494_9950_11725 506
117 3300045051 Ga0451576_0013130 Ga0451576_0013130_6767_8548 506
118 3300049593 Ga0501077_0001518 Ga0501077_0001518_1932_3689 506
119 3300050510 nmdc:mga06r32_2783_c1 nmdc:mga06r32_2783_c1_7873_9606 506
120 3300006852 Ga0075433_10017254 Ga0075433_100172543 508
121 3300006871 Ga0075434_100027437 Ga0075434_1000274376 508
122 3300050512 nmdc:mga0n895_8381_c1 nmdc:mga0n895_8381_c1_3751_5538 508
123 3300050513 nmdc:mga0rr50_13279_c1 nmdc:mga0rr50_13279_c1_3245_5032 508
124 3300050515 nmdc:mga0a205_27740_c1 nmdc:mga0a205_27740_c1_502_2289 508
125 3300005353 Ga0070669_100036050 Ga0070669_1000360503 509
126 3300005467 Ga0070706_100011735 Ga0070706_1000117354 509
127 3300005617 Ga0068859_100051477 Ga0068859_1000514772 509
128 3300006931 Ga0097620_100051476 Ga0097620_1000514762 509
129 3300025910 Ga0207684_10064816 Ga0207684_100648162 509
130 3300005295 Ga0065707_10002007 Ga0065707_100020073 510
131 3300006852 Ga0075433_10017759 Ga0075433_100177593 510
132 3300006871 Ga0075434_100007444 Ga0075434_10000744410 510
133 3300007076 Ga0075435_100102915 Ga0075435_1001029152 510
134 3300050508 nmdc:mga09592_62165_c1 nmdc:mga09592_62165_c1_1167_2948 510
135 3300050512 nmdc:mga0n895_96481_c1 nmdc:mga0n895_96481_c1_218_2023 510
136 3300050515 nmdc:mga0a205_27359_c1 nmdc:mga0a205_27359_c1_3169_4974 510
137 3300005336 Ga0070680_100047907 Ga0070680_1000479073 511
138 3300005457 Ga0070662_100035314 Ga0070662_1000353143 511
139 3300005543 Ga0070672_100042612 Ga0070672_1000426123 511
140 3300005719 Ga0068861_100059458 Ga0068861_1000594581 511
141 3300005840 Ga0068870_10027765 Ga0068870_100277651 511
142 3300005844 Ga0068862_100093924 Ga0068862_1000939242 511
143 3300006847 Ga0075431_100064086 Ga0075431_1000640862 511
144 3300009147 Ga0114129_10181217 Ga0114129_101812172 511
145 3300025907 Ga0207645_10029252 Ga0207645_100292521 511
146 3300025908 Ga0207643_10030031 Ga0207643_100300311 511
147 3300025933 Ga0207706_10004202 Ga0207706_100042027 511
148 3300025940 Ga0207691_10020233 Ga0207691_100202333 511
149 3300026118 Ga0207675_100005176 Ga0207675_10000517612 511
150 3300027617 Ga0210002_1000639 Ga0210002_10006392 511
151 3300027665 Ga0209983_1006818 Ga0209983_10068181 511
152 3300027682 Ga0209971_1002103 Ga0209971_10021033 511
153 3300027876 Ga0209974_10000535 Ga0209974_1000053512 511
154 3300048908 Ga0496105_0056074 Ga0496105_0056074_686_2434 511
155 3300050509 nmdc:mga0qj67_60428_c1 nmdc:mga0qj67_60428_c1_879_2567 511
156 3300050509 nmdc:mga0qj67_97543_c1 nmdc:mga0qj67_97543_c1_68_1756 511
157 3300050510 nmdc:mga06r32_39501_c1 nmdc:mga06r32_39501_c1_1620_3308 511
158 3300003320 rootH2_10183569 rootH2_101835691 512
159 3300037418 Ga0395900_0026358 Ga0395900_0026358_2801_4576 512
160 iso_pu_bacteria 2643221695 2644529082 512
161 3300005937 Ga0081455_10000287 Ga0081455_1000028737 513
162 3300005289 Ga0065704_10100215 Ga0065704_101002151 514
163 3300005841 Ga0068863_100069960 Ga0068863_1000699602 514
164 3300025922 Ga0207646_10041022 Ga0207646_100410223 514
165 3300006846 Ga0075430_100001464 Ga0075430_10000146411 515
166 3300006847 Ga0075431_100005258 Ga0075431_10000525810 515
167 3300006852 Ga0075433_10004156 Ga0075433_100041568 515
168 3300006871 Ga0075434_100000483 Ga0075434_1000004834 515
169 3300006880 Ga0075429_100009031 Ga0075429_1000090312 515
170 3300009147 Ga0114129_10010744 Ga0114129_100107442 515
171 3300050507 nmdc:mga05p37_38609_c1 nmdc:mga05p37_38609_c1_2773_4479 515
172 3300050508 nmdc:mga09592_7649_c1 nmdc:mga09592_7649_c1_6070_7806 515
173 3300050509 nmdc:mga0qj67_7284_c1 nmdc:mga0qj67_7284_c1_1487_3223 515
174 3300050510 nmdc:mga06r32_9015_c1 nmdc:mga06r32_9015_c1_2357_4093 515
175 3300050512 nmdc:mga0n895_26798_c1 nmdc:mga0n895_26798_c1_1283_3067 515
176 3300050513 nmdc:mga0rr50_49705_c1 nmdc:mga0rr50_49705_c1_102_1886 515
177 3300050515 nmdc:mga0a205_450_c1 nmdc:mga0a205_450_c1_28548_30332 515
178 3300005436 Ga0070713_100027500 Ga0070713_1000275003 520
179 2162886012 MBSR1b_contig_5973844 MBSR1b_0581.00002590 531
180 3300005293 Ga0065715_10119301 Ga0065715_101193011 531

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xrr-assembly2.cif.gz_B structure of sciw bound to the rhs1 transmembrane domain from salmonella typhimurium 0.638 220 266
6xrr-assembly4.cif.gz_H structure of sciw bound to the rhs1 transmembrane domain from salmonella typhimurium 0.5717 213 267
6zqa-assembly1.cif.gz_UG cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state a (poly-ala) 0.5482 113 466
4wyk-assembly1.cif.gz_C structure of the lrr and ntf2-like domains of nxf1 complexed with nxt1 0.5141 357 417
5wlc-assembly1.cif.gz_LW the complete structure of the small subunit processome 0.5105 111 526
ID Description Score Start End Superfamily
af_K7N4E5_123_231_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.6199 164 245 2.115.10.20
af_Q54MT0_1_326_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6043 95 528 2.130.10.10
af_Q8H919_262_503_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.5904 120 245 2.130.10.10
af_Q20075_21_148_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5864 364 416 3.10.450.50
af_Q54MT0_1_326_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.579 95 528 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A3D1AXH4-F1-model_v4 Uncharacterized protein 0.9694 108 238
AF-A0A2V9YH06-F1-model_v4 Uncharacterized protein 0.9627 196 530
AF-A0A538PHL6-F1-model_v4 P/Homo B domain-containing protein 0.9577 75 530 GO:0004252
GO:0006508
AF-A0A2V9UV64-F1-model_v4 Uncharacterized protein 0.9573 59 526 GO:0005737
GO:0042995
AF-A0A535D5H5-F1-model_v4 DUF11 domain-containing protein 0.9551 75 531

Feature Viewer

pLDDT pTM Quality
83.8 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map