F274187

General Info

Members Datasets Scaffolds Average Seq Length
179 133 358 173

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0546515|Ga0436361_0546515_1874_2488
Length 204
Sequence MELDFAQLPANLARSLMEAGSASRGVRGRVNKQVTRDRYMSPETLFRMHLVLGYVAWLLCFGAYIWPRLEAMSRIEAQRAIAALHSFRFFGLVFILPGVVGNLPAGFATFAAYGDLATGLLAMLALLTVRTRPLFWLFVVAFNLVGVADLIVDYFHAIQLGLPAHAGEFGAAYAIPIIYVPLLMITHFVAFYLMARPQGRQAAE

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
109 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
131 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
132 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
133 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 1.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.91
Nodule 0
Rhizoplane 7.26
Rhizosphere 85.47
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0546515 3300039447 Bacteria 3412
2 rootL2_10107013 3300003322 Bacteria 1263
3 Ga0070690_100118701 3300005330 Bacteria 1773
4 Ga0070670_100422226 3300005331 Bacteria 1179
5 Ga0070660_100146768 3300005339 Bacteria 1895
6 Ga0070689_100090576 3300005340 Bacteria 2410
7 Ga0070689_100194203 3300005340 Bacteria 1654
8 Ga0070661_100560103 3300005344 Bacteria 920
9 Ga0070668_101211531 3300005347 Bacteria 684
10 Ga0070688_100469558 3300005365 Bacteria 944
11 Ga0070659_100093623 3300005366 Bacteria 2411
12 Ga0070709_10300955 3300005434 Bacteria 1171
13 Ga0070713_100284583 3300005436 Bacteria 1518
14 Ga0070713_100661616 3300005436 Bacteria 995
15 Ga0070713_100798259 3300005436 Bacteria 905
16 Ga0070713_101083944 3300005436 Bacteria 774
17 Ga0070711_100728059 3300005439 Bacteria 837
18 Ga0070662_100312199 3300005457 Bacteria 1280
19 Ga0068867_100114087 3300005459 Bacteria 2080
20 Ga0070685_10420347 3300005466 Bacteria 930
21 Ga0070684_100071052 3300005535 Bacteria 3063
22 Ga0070684_100604901 3300005535 Bacteria 1019
23 Ga0070695_100316751 3300005545 Bacteria 1158
24 Ga0070696_100563922 3300005546 Bacteria 914
25 Ga0070693_100055639 3300005547 Bacteria 2280
26 Ga0070665_100296283 3300005548 Bacteria 1620
27 Ga0068855_101783117 3300005563 Bacteria 626
28 Ga0068855_102092583 3300005563 Bacteria 570
29 Ga0068857_100085134 3300005577 Bacteria 2825
30 Ga0068854_100978385 3300005578 Bacteria 748
31 Ga0068856_100045933 3300005614 Bacteria 4301
32 Ga0068856_100196379 3300005614 Bacteria 2032
33 Ga0068856_100257056 3300005614 Bacteria 1762
34 Ga0068856_100645582 3300005614 Bacteria 1079
35 Ga0068852_100048753 3300005616 Bacteria 3620
36 Ga0068852_100117628 3300005616 Bacteria 2427
37 Ga0068859_101619903 3300005617 Bacteria 715
38 Ga0068861_100027685 3300005719 Bacteria 4132
39 Ga0068861_100111986 3300005719 Bacteria 2188
40 Ga0068858_100269131 3300005842 Bacteria 1621
41 Ga0081455_10195442 3300005937 Bacteria 1519
42 Ga0070715_10049500 3300006163 Bacteria 1801
43 Ga0070716_100001938 3300006173 Bacteria 9402
44 Ga0070712_100006270 3300006175 Bacteria 7367
45 Ga0070712_100280965 3300006175 Bacteria 1341
46 Ga0075367_10195674 3300006178 Bacteria 1262
47 Ga0075370_10403815 3300006353 Bacteria 820
48 Ga0075428_100065374 3300006844 Bacteria 3983
49 Ga0075431_100102116 3300006847 Bacteria 2959
50 Ga0075433_10183697 3300006852 Bacteria 1861
51 Ga0075434_100193113 3300006871 Bacteria 2056
52 Ga0075429_100102119 3300006880 Bacteria 2503
53 Ga0068865_100027057 3300006881 Bacteria 3785
54 Ga0075436_100060513 3300006914 Bacteria 2616
55 Ga0097620_101619437 3300006931 Bacteria 715
56 Ga0075435_100008339 3300007076 Bacteria 7427
57 Ga0075435_100099834 3300007076 Bacteria 2404
58 Ga0105240_10045781 3300009093 Bacteria 5548
59 Ga0105247_10047868 3300009101 Bacteria 2626
60 Ga0105247_10064421 3300009101 Bacteria 2277
61 Ga0114129_11306662 3300009147 Bacteria 899
62 Ga0105241_10091973 3300009174 Bacteria 2395
63 Ga0105242_10074953 3300009176 Bacteria 2816
64 Ga0105237_10174045 3300009545 Bacteria 2153
65 Ga0105237_10636949 3300009545 Bacteria 1073
66 Ga0105238_10051822 3300009551 Bacteria 4126
67 Ga0105238_10590807 3300009551 Bacteria 1117
68 Ga0105249_11001619 3300009553 Bacteria 904
69 Ga0157369_10155704 3300013105 Bacteria 2413
70 Ga0157369_11669853 3300013105 Unclassified 647
71 Ga0157378_10645481 3300013297 Bacteria 1074
72 Ga0163162_11787747 3300013306 Bacteria 702
73 Ga0157372_10007408 3300013307 Bacteria 11670
74 Ga0157375_10158514 3300013308 Bacteria 2404
75 Ga0163163_10000374 3300014325 Bacteria 42870
76 Ga0157379_10015985 3300014968 Bacteria 6597
77 Ga0157379_10087863 3300014968 Bacteria 2787
78 Ga0213876_10046405 3300021384 Bacteria 2297
79 Ga0213875_10000009 3300021388 Bacteria 451129
80 Ga0224712_10332788 3300022467 Bacteria 715
81 Ga0207426_1031040 3300025302 Bacteria 1747
82 Ga0207685_10225091 3300025905 Bacteria 894
83 Ga0207645_10086053 3300025907 Bacteria 2019
84 Ga0207654_10094919 3300025911 Bacteria 1826
85 Ga0207671_10406216 3300025914 Bacteria 1083
86 Ga0207671_10443062 3300025914 Bacteria 1034
87 Ga0207693_10017285 3300025915 Bacteria 5753
88 Ga0207693_10138831 3300025915 Bacteria 1911
89 Ga0207663_10093867 3300025916 Bacteria 1998
90 Ga0207663_11015543 3300025916 Bacteria 665
91 Ga0207660_10428964 3300025917 Bacteria 1067
92 Ga0207657_10154887 3300025919 Bacteria 1864
93 Ga0207649_10218900 3300025920 Bacteria 1355
94 Ga0207694_10009629 3300025924 Bacteria 7286
95 Ga0207694_10954122 3300025924 Bacteria 725
96 Ga0207650_10645039 3300025925 Bacteria 892
97 Ga0207690_10026954 3300025932 Bacteria 3626
98 Ga0207706_10148500 3300025933 Bacteria 2062
99 Ga0207686_10090051 3300025934 Bacteria 2023
100 Ga0207670_10071111 3300025936 Bacteria 2405
101 Ga0207665_10000101 3300025939 Bacteria 55649
102 Ga0207679_10410277 3300025945 Bacteria 1193
103 Ga0207658_11235170 3300025986 Bacteria 683
104 Ga0207703_10178500 3300026035 Bacteria 1873
105 Ga0207703_10482130 3300026035 Bacteria 1162
106 Ga0207639_10171427 3300026041 Bacteria 1838
107 Ga0207702_10211230 3300026078 Bacteria 1804
108 Ga0207702_10352367 3300026078 Bacteria 1409
109 Ga0207702_10544503 3300026078 Bacteria 1135
110 Ga0207648_10134297 3300026089 Bacteria 2179
111 Ga0207675_100018289 3300026118 Bacteria 6534
112 Ga0207675_100402374 3300026118 Bacteria 1349
113 Ga0207675_101535799 3300026118 Bacteria 686
114 Ga0207698_10034805 3300026142 Bacteria 3677
115 Ga0207698_10116999 3300026142 Bacteria 2248
116 Ga0209982_1038156 3300027552 Bacteria 763
117 Ga0209971_1038962 3300027682 Bacteria 1144
118 Ga0207428_10173462 3300027907 Bacteria 1632
119 Ga0268266_10044794 3300028379 Bacteria 3783
120 Ga0268266_10166580 3300028379 Bacteria 1997
121 Ga0268266_10211710 3300028379 Bacteria 1778
122 Ga0265760_10015673 3300031090 Bacteria 2174
123 Ga0373958_0011252 3300034819 Bacteria 1509
124 Ga0373931_0017137 3300035691 Bacteria 3577
125 Ga0373927_0208026 3300035695 Bacteria 1285
126 Ga0395900_0356127 3300037418 Bacteria 1436
127 Ga0395900_0456520 3300037418 Bacteria 1233
128 Ga0395898_0045766 3300037466 Bacteria 4300
129 Ga0395898_0519811 3300037466 Bacteria 1132
130 Ga0395898_0941671 3300037466 Bacteria 801
131 Ga0395905_0035148 3300037471 Bacteria 4705
132 Ga0395905_0078987 3300037471 Bacteria 3083
133 Ga0395905_0081948 3300037471 Bacteria 3023
134 Ga0395905_0876362 3300037471 Bacteria 801
135 Ga0395905_0895543 3300037471 Bacteria 790
136 Ga0436364_0174146 3300037853 Bacteria 60383
137 Ga0395901_0078843 3300038443 Bacteria 3439
138 Ga0395901_0761457 3300038443 Unclassified 960
139 Ga0436365_0637158 3300039437 Bacteria 3243
140 Ga0436360_0769601 3300039438 Bacteria 744
141 Ga0436360_1305981 3300039438 Bacteria 1380
142 Ga0436361_0798680 3300039447 Bacteria 694
143 Ga0436362_0171872 3300039453 Bacteria 1572
144 Ga0466967_0179330 3300045976 Bacteria 1997
145 Ga0495580_0026216 3300046472 Bacteria 4252
146 Ga0495580_0185754 3300046472 Bacteria 1435
147 Ga0495580_0391221 3300046472 Bacteria 938
148 Ga0495625_0458362 3300046660 Bacteria 786
149 Ga0495635_0665247 3300046663 Bacteria 677
150 Ga0495649_0164967 3300046694 Bacteria 1161
151 Ga0495672_0092162 3300047320 Bacteria 1662
152 Ga0496100_0137657 3300048903 Bacteria 1727
153 Ga0496101_0034735 3300048904 Bacteria 3564
154 Ga0496101_0366097 3300048904 Bacteria 1133
155 Ga0496102_0001634 3300048905 Bacteria 19759
156 Ga0496102_0371702 3300048905 Bacteria 1345
157 Ga0496103_0007958 3300048906 Bacteria 6299
158 Ga0496104_0743803 3300048907 Bacteria 888
159 Ga0496105_0536624 3300048908 Bacteria 915
160 Ga0496106_0014532 3300048909 Bacteria 5817
161 Ga0496106_0204694 3300048909 Bacteria 1571
162 Ga0496109_0069779 3300048912 Bacteria 3224
163 Ga0496112_0429655 3300048915 Bacteria 1259
164 Ga0496115_0711852 3300048918 Bacteria 788
165 Ga0496121_0785280 3300048924 Bacteria 562
166 Ga0501046_0413644 3300049580 Bacteria 973
167 Ga0501047_0016182 3300049581 Bacteria 7116
168 Ga0501070_0308450 3300049586 Bacteria 1288
169 Ga0501044_0311666 3300049823 Bacteria 1500
170 nmdc:mga06z11_133847_c1 3300050494 Bacteria 1395
171 nmdc:mga0n895_112879_c1 3300050512 Bacteria 2735
172 nmdc:mga0n895_47001_c1 3300050512 Bacteria 4219
173 nmdc:mga0rr50_9402_c1 3300050513 Bacteria 6142
174 nmdc:mga08x19_154394_c1 3300050514 Bacteria 1556
175 nmdc:mga0a205_289814_c1 3300050515 Bacteria 1511
176 Ga0500643_000008 3300053087 Bacteria 457931
177 Ga0500595_000865 3300053119 Bacteria 17287
178 Ga0500568_0007881 3300053139 Bacteria 5187
179 Ga0466962_0175950 3300061719 Bacteria 1043
180 Ga0436361_0546515
181 rootL2_10107013
182 Ga0070690_100118701
183 Ga0070670_100422226
184 Ga0070660_100146768
185 Ga0070689_100090576
186 Ga0070689_100194203
187 Ga0070661_100560103
188 Ga0070668_101211531
189 Ga0070688_100469558
190 Ga0070659_100093623
191 Ga0070709_10300955
192 Ga0070713_100284583
193 Ga0070713_100661616
194 Ga0070713_100798259
195 Ga0070713_101083944
196 Ga0070711_100728059
197 Ga0070662_100312199
198 Ga0068867_100114087
199 Ga0070685_10420347
200 Ga0070684_100071052
201 Ga0070684_100604901
202 Ga0070695_100316751
203 Ga0070696_100563922
204 Ga0070693_100055639
205 Ga0070665_100296283
206 Ga0068855_101783117
207 Ga0068855_102092583
208 Ga0068857_100085134
209 Ga0068854_100978385
210 Ga0068856_100045933
211 Ga0068856_100196379
212 Ga0068856_100257056
213 Ga0068856_100645582
214 Ga0068852_100048753
215 Ga0068852_100117628
216 Ga0068859_101619903
217 Ga0068861_100027685
218 Ga0068861_100111986
219 Ga0068858_100269131
220 Ga0081455_10195442
221 Ga0070715_10049500
222 Ga0070716_100001938
223 Ga0070712_100006270
224 Ga0070712_100280965
225 Ga0075367_10195674
226 Ga0075370_10403815
227 Ga0075428_100065374
228 Ga0075431_100102116
229 Ga0075433_10183697
230 Ga0075434_100193113
231 Ga0075429_100102119
232 Ga0068865_100027057
233 Ga0075436_100060513
234 Ga0097620_101619437
235 Ga0075435_100008339
236 Ga0075435_100099834
237 Ga0105240_10045781
238 Ga0105247_10047868
239 Ga0105247_10064421
240 Ga0114129_11306662
241 Ga0105241_10091973
242 Ga0105242_10074953
243 Ga0105237_10174045
244 Ga0105237_10636949
245 Ga0105238_10051822
246 Ga0105238_10590807
247 Ga0105249_11001619
248 Ga0157369_10155704
249 Ga0157369_11669853
250 Ga0157378_10645481
251 Ga0163162_11787747
252 Ga0157372_10007408
253 Ga0157375_10158514
254 Ga0163163_10000374
255 Ga0157379_10015985
256 Ga0157379_10087863
257 Ga0213876_10046405
258 Ga0213875_10000009
259 Ga0224712_10332788
260 Ga0207426_1031040
261 Ga0207685_10225091
262 Ga0207645_10086053
263 Ga0207654_10094919
264 Ga0207671_10406216
265 Ga0207671_10443062
266 Ga0207693_10017285
267 Ga0207693_10138831
268 Ga0207663_10093867
269 Ga0207663_11015543
270 Ga0207660_10428964
271 Ga0207657_10154887
272 Ga0207649_10218900
273 Ga0207694_10009629
274 Ga0207694_10954122
275 Ga0207650_10645039
276 Ga0207690_10026954
277 Ga0207706_10148500
278 Ga0207686_10090051
279 Ga0207670_10071111
280 Ga0207665_10000101
281 Ga0207679_10410277
282 Ga0207658_11235170
283 Ga0207703_10178500
284 Ga0207703_10482130
285 Ga0207639_10171427
286 Ga0207702_10211230
287 Ga0207702_10352367
288 Ga0207702_10544503
289 Ga0207648_10134297
290 Ga0207675_100018289
291 Ga0207675_100402374
292 Ga0207675_101535799
293 Ga0207698_10034805
294 Ga0207698_10116999
295 Ga0209982_1038156
296 Ga0209971_1038962
297 Ga0207428_10173462
298 Ga0268266_10044794
299 Ga0268266_10166580
300 Ga0268266_10211710
301 Ga0265760_10015673
302 Ga0373958_0011252
303 Ga0373931_0017137
304 Ga0373927_0208026
305 Ga0395900_0356127
306 Ga0395900_0456520
307 Ga0395898_0045766
308 Ga0395898_0519811
309 Ga0395898_0941671
310 Ga0395905_0035148
311 Ga0395905_0078987
312 Ga0395905_0081948
313 Ga0395905_0876362
314 Ga0395905_0895543
315 Ga0436364_0174146
316 Ga0395901_0078843
317 Ga0395901_0761457
318 Ga0436365_0637158
319 Ga0436360_0769601
320 Ga0436360_1305981
321 Ga0436361_0798680
322 Ga0436362_0171872
323 Ga0466967_0179330
324 Ga0495580_0026216
325 Ga0495580_0185754
326 Ga0495580_0391221
327 Ga0495625_0458362
328 Ga0495635_0665247
329 Ga0495649_0164967
330 Ga0495672_0092162
331 Ga0496100_0137657
332 Ga0496101_0034735
333 Ga0496101_0366097
334 Ga0496102_0001634
335 Ga0496102_0371702
336 Ga0496103_0007958
337 Ga0496104_0743803
338 Ga0496105_0536624
339 Ga0496106_0014532
340 Ga0496106_0204694
341 Ga0496109_0069779
342 Ga0496112_0429655
343 Ga0496115_0711852
344 Ga0496121_0785280
345 Ga0501046_0413644
346 Ga0501047_0016182
347 Ga0501070_0308450
348 Ga0501044_0311666
349 nmdc:mga06z11_133847_c1
350 nmdc:mga0n895_112879_c1
351 nmdc:mga0n895_47001_c1
352 nmdc:mga0rr50_9402_c1
353 nmdc:mga08x19_154394_c1
354 nmdc:mga0a205_289814_c1
355 Ga0500643_000008
356 Ga0500595_000865
357 Ga0500568_0007881
358 Ga0466962_0175950

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6q58-assembly1.cif.gz_A copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) 0.6768 34 160
6q58-assembly1.cif.gz_A copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) 0.649 34 160
6qyb-assembly1.cif.gz_A streptomyces lividans ccsp mutant - h111a 0.6204 34 155
6r01-assembly1.cif.gz_A streptomyces lividans ccsp mutant - h107a/h111a 0.6038 34 154
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.595 33 155
ID Description Score Start End Superfamily
af_A0A0P0X6X2_2_109_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.7073 37 116 1.20.58.390
af_P47987_32_160_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6899 38 153 1.20.140.150
af_Q8TAZ6_82_211_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6846 38 154 1.20.140.150
af_Q1G390_33_180_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.6792 31 151 1.20.140.40
af_K7MBN0_417_531_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6774 34 116 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A3P3FI86-F1-model_v4 Uncharacterized protein 0.9498 1 153 GO:0016020
AF-A0A176Z329-F1-model_v4 Uncharacterized protein 0.9489 1 157 GO:0016020
AF-A0A371WTX3-F1-model_v4 Uncharacterized protein 0.9488 1 156 GO:0016020
AF-A0A4R3E4V1-F1-model_v4 Uncharacterized protein 0.9488 1 156 GO:0016020
AF-A0A432MAA7-F1-model_v4 Transmembrane protein 0.9402 1 160 GO:0016020

Map