F273484

General Info

Members Datasets Scaffolds Average Seq Length
179 139 174 254

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100038943|Ga0070665_1000389432
Length 286
Sequence MGVRLYGMTCGWLTMPFQFFMPGAEGWIAIPVPAYLVVHPKGTALFDTGLETALSSKDEATRNAALGPAAGFALPIIEADEDVAGRLRAFGVAPDKIDYLINSHLHMDHCGGNAAIRNARLIIQKREWEAGGIPELVQENIYLSHQYDLGHDRLEIDGEHDLFGDGSVVLVPTFGHTPGHQSLRVRLADGEVLLTADACYLRETLDGMILPDPAVVRSADAMRANYEFLKRAEQQGALLVFGHDPDQWRNLNSGPIQEITSAAVLNAQRIARPNRADSMASPFAQA

Samples

Sample ID Description Type Environment
1 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
2 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
3 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
4 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
5 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
89 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
90 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
91 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
106 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
121 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
131 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
137 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
139 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.09
Metatranscriptomes 1.12
Isolates 2.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.79
Nodule 1.12
Rhizoplane 2.23
Rhizosphere 83.24
Stem 0
Stem Tuber 0
Unclassified 10.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10011447 3300002239 Bacteria 1329
2 JGI25406J46586_10086821 3300003203 Bacteria 949
3 Ga0055531_10036221 3300003794 Bacteria 1527
4 Ga0065704_10000421 3300005289 Bacteria 24733
5 Ga0070683_100441874 3300005329 Bacteria 1241
6 Ga0070677_10171797 3300005333 Bacteria 1025
7 Ga0070680_100041571 3300005336 Bacteria 3727
8 Ga0070680_100101332 3300005336 Bacteria 2390
9 Ga0070668_100004052 3300005347 Bacteria 10848
10 Ga0070668_100026672 3300005347 Bacteria 4385
11 Ga0070671_100026612 3300005355 Bacteria 4755
12 Ga0070674_100003432 3300005356 Bacteria 8894
13 Ga0070714_100323033 3300005435 Unclassified 1444
14 Ga0070713_100547083 3300005436 Unclassified 1096
15 Ga0070710_10064614 3300005437 Unclassified 2094
16 Ga0070711_100067808 3300005439 Bacteria 2505
17 Ga0070694_100029812 3300005444 Bacteria 3564
18 Ga0070681_10114593 3300005458 Bacteria 2634
19 Ga0068867_100071384 3300005459 Bacteria 2597
20 Ga0070707_100073319 3300005468 Bacteria 3300
21 Ga0070679_100023123 3300005530 Bacteria 6081
22 Ga0070679_100615557 3300005530 Bacteria 1029
23 Ga0070697_100257409 3300005536 Bacteria 1493
24 Ga0068853_100084711 3300005539 Bacteria 2778
25 Ga0070665_100004613 3300005548 Bacteria 14405
26 Ga0070665_100038943 3300005548 Bacteria 4779
27 Ga0070665_100195385 3300005548 Bacteria 2024
28 Ga0068855_100042165 3300005563 Bacteria 5408
29 Ga0068855_100698671 3300005563 Bacteria 1085
30 Ga0068857_100022474 3300005577 Bacteria 5549
31 Ga0068856_100558195 3300005614 Bacteria 1166
32 Ga0068852_100032768 3300005616 Bacteria 4305
33 Ga0068866_10130925 3300005718 Bacteria 1427
34 Ga0068861_100215365 3300005719 Bacteria 1620
35 Ga0081455_10001171 3300005937 Bacteria 32831
36 Ga0081539_10015238 3300005985 Bacteria 5602
37 Ga0081539_10022021 3300005985 Bacteria 4231
38 Ga0070716_100053966 3300006173 Bacteria 2294
39 Ga0070716_100169605 3300006173 Bacteria 1423
40 Ga0070712_100014587 3300006175 Bacteria 5043
41 Ga0075433_10462467 3300006852 Bacteria 1118
42 Ga0075434_100039527 3300006871 Bacteria 4675
43 Ga0075436_100083209 3300006914 Bacteria 2220
44 Ga0075436_100463129 3300006914 Bacteria 924
45 Ga0099823_1026912 3300006944 Bacteria 5046
46 Ga0099794_10011439 3300007265 Bacteria 3799
47 Ga0105250_10022104 3300009092 Bacteria 2566
48 Ga0105240_10006155 3300009093 Bacteria 17688
49 Ga0105240_10078744 3300009093 Bacteria 4058
50 Ga0111539_10033792 3300009094 Bacteria 6207
51 Ga0105247_10221894 3300009101 Bacteria 1280
52 Ga0114129_10247608 3300009147 Bacteria 2394
53 Ga0114129_10567894 3300009147 Bacteria 1473
54 Ga0105241_10205356 3300009174 Bacteria 1648
55 Ga0105248_10061509 3300009177 Bacteria 4216
56 Ga0105238_10106621 3300009551 Bacteria 2783
57 Ga0105238_10349540 3300009551 Bacteria 1467
58 Ga0099796_10147298 3300010159 Bacteria 924
59 Ga0157370_10013910 3300013104 Bacteria 8263
60 Ga0157370_10016725 3300013104 Bacteria 7423
61 Ga0157372_10539365 3300013307 Bacteria 1360
62 Ga0157375_10749569 3300013308 Bacteria 1128
63 Ga0163163_11211032 3300014325 Bacteria 818
64 Ga0157379_10158370 3300014968 Bacteria 2043
65 Ga0213872_10197287 3300021361 Bacteria 864
66 Ga0209026_1007773 3300025250 Bacteria 2340
67 Ga0209673_1012797 3300025273 Bacteria 3355
68 Ga0209257_1000847 3300025304 Bacteria 43768
69 Ga0209257_1002053 3300025304 Bacteria 21366
70 Ga0207696_1009740 3300025711 Plasmid 3566
71 Ga0207713_1053114 3300025735 Bacteria 1599
72 Ga0207713_1053115 3300025735 Unclassified 1599
73 Ga0207642_10014660 3300025899 Bacteria 2899
74 Ga0207710_10200237 3300025900 Unclassified 986
75 Ga0207685_10180707 3300025905 Bacteria 978
76 Ga0207707_10056915 3300025912 Bacteria 3403
77 Ga0207695_10001353 3300025913 Bacteria 41557
78 Ga0207695_10007932 3300025913 Bacteria 13398
79 Ga0207693_10044396 3300025915 Bacteria 3493
80 Ga0207663_10171471 3300025916 Bacteria 1541
81 Ga0207660_10323436 3300025917 Bacteria 1232
82 Ga0207646_10009572 3300025922 Bacteria 9562
83 Ga0207646_10164905 3300025922 Bacteria 2000
84 Ga0207694_10249850 3300025924 Bacteria 1451
85 Ga0207644_10016911 3300025931 Bacteria 4914
86 Ga0207669_10022385 3300025937 Bacteria 3356
87 Ga0207665_10063541 3300025939 Bacteria 2507
88 Ga0207712_10119616 3300025961 Unclassified 1990
89 Ga0207712_10207552 3300025961 Bacteria 1558
90 Ga0207668_10042613 3300025972 Bacteria 3075
91 Ga0207702_10471247 3300026078 Bacteria 1221
92 Ga0207648_10094582 3300026089 Bacteria 2613
93 Ga0207674_10066567 3300026116 Bacteria 3628
94 Ga0207698_10089111 3300026142 Bacteria 2518
95 Ga0209389_1026237 3300027296 Bacteria 5054
96 Ga0268266_10004172 3300028379 Bacteria 13934
97 Ga0268266_10048783 3300028379 Bacteria 3630
98 Ga0268266_10078197 3300028379 Bacteria 2878
99 Ga0268266_10363168 3300028379 Bacteria 1363
100 Ga0307511_10019043 3300030521 Bacteria 6541
101 Ga0265340_10156319 3300031247 Unclassified 1038
102 Ga0265327_10000039 3300031251 Bacteria 292334
103 Ga0307513_10179927 3300031456 Unclassified 1979
104 Ga0373926_0120725 3300035083 Bacteria 988
105 Ga0373934_0032031 3300035086 Bacteria 2061
106 Ga0373953_0067987 3300035117 Bacteria 1466
107 Ga0373956_0002757 3300035119 Bacteria 7105
108 Ga0373935_0099280 3300035692 Bacteria 1917
109 Ga0373935_0311644 3300035692 Bacteria 1115
110 Ga0373933_0097140 3300035724 Bacteria 1824
111 Ga0373937_0005960 3300036401 Bacteria 10492
112 Ga0395899_0075451 3300037312 Bacteria 2462
113 Ga0395899_0083960 3300037312 Bacteria 2315
114 Ga0395899_0156431 3300037312 Bacteria 1613
115 Ga0395899_0310272 3300037312 Bacteria 1065
116 Ga0395900_0004469 3300037418 Bacteria 14817
117 Ga0395900_0036667 3300037418 Bacteria 5055
118 Ga0395900_0098205 3300037418 Bacteria 3009
119 Ga0395898_0003557 3300037466 Bacteria 17370
120 Ga0395898_0058855 3300037466 Bacteria 3740
121 Ga0395898_0219755 3300037466 Bacteria 1812
122 Ga0395905_0005515 3300037471 Bacteria 12906
123 Ga0395905_0055894 3300037471 Bacteria 3694
124 Ga0436364_0500498 3300037853 Bacteria 852
125 Ga0395901_0206388 3300038443 Bacteria 2058
126 Ga0395901_0649335 3300038443 Bacteria 1058
127 Ga0436365_1081678 3300039437 Unclassified 1243
128 Ga0436365_1805243 3300039437 Bacteria 1283
129 Ga0436360_0136129 3300039438 Bacteria 940
130 Ga0436360_0469136 3300039438 Bacteria 875
131 Ga0436360_0691167 3300039438 Bacteria 2462
132 Ga0436360_1133449 3300039438 Bacteria 13512
133 Ga0436361_0924681 3300039447 Bacteria 2063
134 Ga0436361_1057233 3300039447 Bacteria 1879
135 Ga0436363_1126092 3300039450 Bacteria 1336
136 Ga0436362_0136163 3300039453 Bacteria 1423
137 Ga0436362_0552204 3300039453 Bacteria 2222
138 Ga0439431_0074407 3300041997 Bacteria 909
139 Ga0451577_0035706 3300042876 Bacteria 4478
140 Ga0495592_0022398 3300046454 Bacteria 4807
141 Ga0495628_0201225 3300046516 Bacteria 1500
142 Ga0495667_0029541 3300046559 Bacteria 3690
143 Ga0495599_0029847 3300046678 Bacteria 3420
144 Ga0495600_0037624 3300046809 Bacteria 3147
145 Ga0495674_0703974 3300047319 Bacteria 792
146 Ga0495672_0000459 3300047320 Bacteria 48101
147 Ga0495680_0240663 3300047322 Bacteria 1285
148 Ga0495686_0002791 3300047472 Bacteria 15886
149 Ga0496102_0030590 3300048905 Bacteria 4820
150 Ga0496104_0316293 3300048907 Unclassified 1474
151 Ga0496112_0117742 3300048915 Bacteria 2627
152 Ga0496112_0206977 3300048915 Bacteria 1919
153 Ga0496116_0060537 3300048919 Bacteria 2455
154 Ga0496118_0004137 3300048921 Bacteria 17544
155 Ga0496122_0240825 3300048925 Bacteria 1020
156 Ga0496124_0005368 3300048927 Bacteria 14473
157 Ga0496124_0030856 3300048927 Bacteria 4749
158 Ga0496126_0063844 3300048929 Bacteria 3300
159 Ga0496126_0118983 3300048929 Unclassified 2293
160 Ga0501342_00780 3300049163 Unclassified 913
161 Ga0501314_003129 3300049530 Unclassified 1321
162 Ga0501033_0205162 3300049570 Bacteria 1407
163 Ga0501043_0232175 3300049579 Bacteria 1425
164 Ga0501046_0190507 3300049580 Bacteria 1530
165 Ga0501223_000233 3300049663 Bacteria 14249
166 Ga0501233_000088 3300049668 Bacteria 12171
167 Ga0501035_0180498 3300049822 Bacteria 1819
168 Ga0501044_0274300 3300049823 Bacteria 1621
169 nmdc:mga0qj67_445080_c1 3300050509 Bacteria 1044
170 nmdc:mga0n895_377208_c1 3300050512 Unclassified 1435
171 nmdc:mga08x19_616938_c1 3300050514 Bacteria 769
172 Ga0495601_0016257 3300053077 Bacteria 4508
173 Ga0495619_0031385 3300053085 Bacteria 3443
174 Ga0500577_0214263 3300053142 Unclassified 833

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050514 nmdc:mga08x19_616938_c1 nmdc:mga08x19_616938_c1_16_636 198
2 3300039453 Ga0436362_0552204 Ga0436362_0552204_14_691 218
3 3300047322 Ga0495680_0240663 Ga0495680_0240663_10_714 220
4 iso_pu_bacteria 2643221552 2643778402 222
5 3300005539 Ga0068853_100084711 Ga0068853_1000847114 224
6 3300037853 Ga0436364_0500498 Ga0436364_0500498_14_718 227
7 3300009101 Ga0105247_10221894 Ga0105247_102218941 228
8 3300014968 Ga0157379_10158370 Ga0157379_101583702 228
9 3300048905 Ga0496102_0030590 Ga0496102_0030590_3798_4502 228
10 3300048907 Ga0496104_0316293 Ga0496104_0316293_755_1459 228
11 3300005468 Ga0070707_100073319 Ga0070707_1000733191 232
12 3300025304 Ga0209257_1002053 Ga0209257_10020533 232
13 3300025922 Ga0207646_10009572 Ga0207646_1000957211 232
14 3300037312 Ga0395899_0156431 Ga0395899_0156431_121_846 236
15 3300039437 Ga0436365_1081678 Ga0436365_1081678_308_1045 239
16 3300046454 Ga0495592_0022398 Ga0495592_0022398_1055_1819 240
17 3300046559 Ga0495667_0029541 Ga0495667_0029541_1553_2317 240
18 3300046678 Ga0495599_0029847 Ga0495599_0029847_1267_2031 240
19 3300046809 Ga0495600_0037624 Ga0495600_0037624_718_1482 240
20 3300053077 Ga0495601_0016257 Ga0495601_0016257_3160_3924 240
21 3300053085 Ga0495619_0031385 Ga0495619_0031385_1334_2098 240
22 iso_pu_bacteria 2643221598 2643999328 241
23 iso_pu_bacteria 2643221614 2644088843 241
24 iso_pu_bacteria 2643221661 2644345526 241
25 iso_pu_bacteria 2643221666 2644365530 241
26 3300046516 Ga0495628_0201225 Ga0495628_0201225_499_1251 243
27 3300047319 Ga0495674_0703974 Ga0495674_0703974_21_773 243
28 3300009093 Ga0105240_10078744 Ga0105240_100787442 244
29 3300013308 Ga0157375_10749569 Ga0157375_107495692 244
30 3300014325 Ga0163163_11211032 Ga0163163_112110321 244
31 3300025961 Ga0207712_10207552 Ga0207712_102075522 244
32 3300048915 Ga0496112_0206977 Ga0496112_0206977_772_1527 244
33 3300003794 Ga0055531_10036221 Ga0055531_100362212 245
34 3300005347 Ga0070668_100026672 Ga0070668_1000266726 245
35 3300005356 Ga0070674_100003432 Ga0070674_1000034328 245
36 3300005459 Ga0068867_100071384 Ga0068867_1000713842 245
37 3300005718 Ga0068866_10130925 Ga0068866_101309252 245
38 3300005719 Ga0068861_100215365 Ga0068861_1002153652 245
39 3300009174 Ga0105241_10205356 Ga0105241_102053562 245
40 3300009551 Ga0105238_10349540 Ga0105238_103495402 245
41 3300025250 Ga0209026_1007773 Ga0209026_10077732 245
42 3300025304 Ga0209257_1000847 Ga0209257_10008479 245
43 3300025899 Ga0207642_10014660 Ga0207642_100146602 245
44 3300025900 Ga0207710_10200237 Ga0207710_102002371 245
45 3300025922 Ga0207646_10164905 Ga0207646_101649052 245
46 3300025924 Ga0207694_10249850 Ga0207694_102498502 245
47 3300025937 Ga0207669_10022385 Ga0207669_100223852 245
48 3300025972 Ga0207668_10042613 Ga0207668_100426134 245
49 3300026089 Ga0207648_10094582 Ga0207648_100945824 245
50 3300028379 Ga0268266_10363168 Ga0268266_103631681 245
51 3300031251 Ga0265327_10000039 Ga0265327_1000003928 245
52 3300041997 Ga0439431_0074407 Ga0439431_0074407_76_834 245
53 3300047472 Ga0495686_0002791 Ga0495686_0002791_5986_6783 245
54 3300005329 Ga0070683_100441874 Ga0070683_1004418742 246
55 3300005333 Ga0070677_10171797 Ga0070677_101717971 246
56 3300005336 Ga0070680_100041571 Ga0070680_1000415713 246
57 3300005444 Ga0070694_100029812 Ga0070694_1000298124 246
58 3300005536 Ga0070697_100257409 Ga0070697_1002574091 246
59 3300005548 Ga0070665_100195385 Ga0070665_1001953852 246
60 3300005563 Ga0068855_100042165 Ga0068855_1000421653 246
61 3300005563 Ga0068855_100698671 Ga0068855_1006986712 246
62 3300005616 Ga0068852_100032768 Ga0068852_1000327685 246
63 3300006173 Ga0070716_100053966 Ga0070716_1000539663 246
64 3300006173 Ga0070716_100169605 Ga0070716_1001696051 246
65 3300006852 Ga0075433_10462467 Ga0075433_104624672 246
66 3300006871 Ga0075434_100039527 Ga0075434_1000395272 246
67 3300006914 Ga0075436_100083209 Ga0075436_1000832093 246
68 3300007265 Ga0099794_10011439 Ga0099794_100114393 246
69 3300009147 Ga0114129_10247608 Ga0114129_102476082 246
70 3300009147 Ga0114129_10567894 Ga0114129_105678942 246
71 3300009551 Ga0105238_10106621 Ga0105238_101066212 246
72 3300013307 Ga0157372_10539365 Ga0157372_105393652 246
73 3300025905 Ga0207685_10180707 Ga0207685_101807072 246
74 3300025913 Ga0207695_10001353 Ga0207695_100013535 246
75 3300025913 Ga0207695_10007932 Ga0207695_1000793210 246
76 3300025939 Ga0207665_10063541 Ga0207665_100635412 246
77 3300026142 Ga0207698_10089111 Ga0207698_100891112 246
78 3300028379 Ga0268266_10078197 Ga0268266_100781972 246
79 3300030521 Ga0307511_10019043 Ga0307511_100190436 246
80 3300037312 Ga0395899_0083960 Ga0395899_0083960_1025_1801 246
81 3300037418 Ga0395900_0036667 Ga0395900_0036667_3774_4541 246
82 3300037466 Ga0395898_0058855 Ga0395898_0058855_2314_3081 246
83 3300037466 Ga0395898_0219755 Ga0395898_0219755_1025_1801 246
84 3300037471 Ga0395905_0005515 Ga0395905_0005515_9226_9987 246
85 3300037471 Ga0395905_0055894 Ga0395905_0055894_2048_2815 246
86 3300038443 Ga0395901_0206388 Ga0395901_0206388_447_1214 246
87 3300038443 Ga0395901_0649335 Ga0395901_0649335_259_1035 246
88 3300048915 Ga0496112_0117742 Ga0496112_0117742_895_1656 246
89 3300050512 nmdc:mga0n895_377208_c1 nmdc:mga0n895_377208_c1_582_1358 246
90 3300003203 JGI25406J46586_10086821 JGI25406J46586_100868211 247
91 3300005336 Ga0070680_100101332 Ga0070680_1001013322 247
92 3300005435 Ga0070714_100323033 Ga0070714_1003230332 247
93 3300005436 Ga0070713_100547083 Ga0070713_1005470833 247
94 3300005458 Ga0070681_10114593 Ga0070681_101145932 247
95 3300005530 Ga0070679_100023123 Ga0070679_1000231233 247
96 3300005530 Ga0070679_100615557 Ga0070679_1006155571 247
97 3300005548 Ga0070665_100038943 Ga0070665_1000389432 247
98 3300005577 Ga0068857_100022474 Ga0068857_1000224746 247
99 3300005614 Ga0068856_100558195 Ga0068856_1005581952 247
100 3300005937 Ga0081455_10001171 Ga0081455_1000117113 247
101 3300005985 Ga0081539_10015238 Ga0081539_100152382 247
102 3300005985 Ga0081539_10022021 Ga0081539_100220214 247
103 3300006175 Ga0070712_100014587 Ga0070712_1000145872 247
104 3300006914 Ga0075436_100463129 Ga0075436_1004631292 247
105 3300009093 Ga0105240_10006155 Ga0105240_100061557 247
106 3300010159 Ga0099796_10147298 Ga0099796_101472982 247
107 3300013104 Ga0157370_10013910 Ga0157370_100139107 247
108 3300013104 Ga0157370_10016725 Ga0157370_100167253 247
109 3300021361 Ga0213872_10197287 Ga0213872_101972871 247
110 3300025273 Ga0209673_1012797 Ga0209673_10127973 247
111 3300025912 Ga0207707_10056915 Ga0207707_100569151 247
112 3300025915 Ga0207693_10044396 Ga0207693_100443963 247
113 3300025916 Ga0207663_10171471 Ga0207663_101714712 247
114 3300025917 Ga0207660_10323436 Ga0207660_103234362 247
115 3300026078 Ga0207702_10471247 Ga0207702_104712472 247
116 3300026116 Ga0207674_10066567 Ga0207674_100665672 247
117 3300028379 Ga0268266_10048783 Ga0268266_100487832 247
118 3300031247 Ga0265340_10156319 Ga0265340_101563191 247
119 3300035083 Ga0373926_0120725 Ga0373926_0120725_199_960 247
120 3300035086 Ga0373934_0032031 Ga0373934_0032031_666_1427 247
121 3300035117 Ga0373953_0067987 Ga0373953_0067987_615_1376 247
122 3300035119 Ga0373956_0002757 Ga0373956_0002757_1613_2374 247
123 3300035692 Ga0373935_0099280 Ga0373935_0099280_879_1640 247
124 3300035692 Ga0373935_0311644 Ga0373935_0311644_341_1105 247
125 3300035724 Ga0373933_0097140 Ga0373933_0097140_662_1423 247
126 3300036401 Ga0373937_0005960 Ga0373937_0005960_6431_7192 247
127 3300037312 Ga0395899_0075451 Ga0395899_0075451_468_1235 247
128 3300037312 Ga0395899_0310272 Ga0395899_0310272_197_964 247
129 3300037418 Ga0395900_0004469 Ga0395900_0004469_6485_7252 247
130 3300037418 Ga0395900_0098205 Ga0395900_0098205_1888_2655 247
131 3300037466 Ga0395898_0003557 Ga0395898_0003557_6561_7328 247
132 3300039437 Ga0436365_1805243 Ga0436365_1805243_110_874 247
133 3300039438 Ga0436360_0136129 Ga0436360_0136129_15_779 247
134 3300039438 Ga0436360_0469136 Ga0436360_0469136_57_821 247
135 3300039438 Ga0436360_1133449 Ga0436360_1133449_9901_10668 247
136 3300039447 Ga0436361_0924681 Ga0436361_0924681_101_865 247
137 3300039447 Ga0436361_1057233 Ga0436361_1057233_533_1297 247
138 3300039450 Ga0436363_1126092 Ga0436363_1126092_180_944 247
139 3300039453 Ga0436362_0136163 Ga0436362_0136163_215_979 247
140 3300042876 Ga0451577_0035706 Ga0451577_0035706_204_971 247
141 3300048927 Ga0496124_0030856 Ga0496124_0030856_2420_3166 247
142 3300048929 Ga0496126_0118983 Ga0496126_0118983_1247_1993 247
143 3300049163 Ga0501342_00780 Ga0501342_00780_105_851 247
144 3300049570 Ga0501033_0205162 Ga0501033_0205162_267_1034 247
145 3300049579 Ga0501043_0232175 Ga0501043_0232175_590_1357 247
146 3300049580 Ga0501046_0190507 Ga0501046_0190507_652_1419 247
147 3300049663 Ga0501223_000233 Ga0501223_000233_7255_8001 247
148 3300049668 Ga0501233_000088 Ga0501233_000088_9968_10714 247
149 3300049822 Ga0501035_0180498 Ga0501035_0180498_562_1329 247
150 3300049823 Ga0501044_0274300 Ga0501044_0274300_560_1327 247
151 3300050509 nmdc:mga0qj67_445080_c1 nmdc:mga0qj67_445080_c1_36_797 247
152 3300053142 Ga0500577_0214263 Ga0500577_0214263_26_793 247
153 3300005437 Ga0070710_10064614 Ga0070710_100646142 248
154 3300005439 Ga0070711_100067808 Ga0070711_1000678082 248
155 3300006944 Ga0099823_1026912 Ga0099823_10269122 248
156 3300009094 Ga0111539_10033792 Ga0111539_100337927 248
157 3300027296 Ga0209389_1026237 Ga0209389_10262375 248
158 3300031456 Ga0307513_10179927 Ga0307513_101799272 248
159 3300039438 Ga0436360_0691167 Ga0436360_0691167_286_1245 248
160 3300047320 Ga0495672_0000459 Ga0495672_0000459_12810_13562 248
161 3300048925 Ga0496122_0240825 Ga0496122_0240825_88_915 248
162 3300048929 Ga0496126_0063844 Ga0496126_0063844_1120_1926 248
163 3300002239 JGI24034J26672_10011447 JGI24034J26672_100114472 249
164 3300005289 Ga0065704_10000421 Ga0065704_100004213 249
165 3300005347 Ga0070668_100004052 Ga0070668_1000040526 249
166 3300005355 Ga0070671_100026612 Ga0070671_1000266124 249
167 3300005548 Ga0070665_100004613 Ga0070665_1000046132 249
168 3300009092 Ga0105250_10022104 Ga0105250_100221041 249
169 3300009177 Ga0105248_10061509 Ga0105248_100615093 249
170 3300025711 Ga0207696_1009740 Ga0207696_10097403 249
171 3300025735 Ga0207713_1053114 Ga0207713_10531142 249
172 3300025735 Ga0207713_1053115 Ga0207713_10531152 249
173 3300025931 Ga0207644_10016911 Ga0207644_100169113 249
174 3300025961 Ga0207712_10119616 Ga0207712_101196162 249
175 3300028379 Ga0268266_10004172 Ga0268266_1000417212 249
176 3300048919 Ga0496116_0060537 Ga0496116_0060537_966_1715 249
177 3300048921 Ga0496118_0004137 Ga0496118_0004137_15102_15851 249
178 3300048927 Ga0496124_0005368 Ga0496124_0005368_1636_2385 249
179 3300049530 Ga0501314_003129 Ga0501314_003129_34_825 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

27

243

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2btn-assembly1.cif.gz_A crystal structure and catalytic mechanism of the quorum-quenching n- acyl homoserine lactone hydrolase 0.9014 5 243
2br6-assembly1.cif.gz_A crystal structure of quorum-quenching n-acyl homoserine lactone lactonase 0.8913 5 247
5eh9-assembly1.cif.gz_A indirect contributions of mutations underlie optimization of new enzyme function 0.8721 5 243
3dha-assembly1.cif.gz_A an ultral high resolution structure of n-acyl homoserine lactone hydrolase with the product n-hexanoyl-l-homoserine bound at an alternative site 0.8712 1 243
4j5h-assembly1.cif.gz_A crystal structure of b. thuringiensis aiia mutant f107w with n-decanoyl-l-homoserine bound at the active site 0.8703 5 243
ID Description Score Start End Superfamily
5ehtA01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8683 3 236 3.60.15.10
6n9qD00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8622 4 244 3.60.15.10
2r2dE00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8551 3 248 3.60.15.10
2r2dE00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8455 3 248 3.60.15.10
6n9qD00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8364 4 244 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A7W5QIL2-F1-model_v4 Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) 0.9585 4 248 GO:0016787
AF-A0A0P0DR19-F1-model_v4 deleted 0.9545 1 248
AF-A0A0P0DR19-F1-model_v4 deleted 0.9508 1 248
AF-A0A2V5CPU0-F1-model_v4 deleted 0.9507 3 248
AF-A0A534RB90-F1-model_v4 N-acyl homoserine lactonase family protein 0.9497 70 243

Feature Viewer

pLDDT pTM Quality
92.38 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map