F273419

General Info

Members Datasets Scaffolds Average Seq Length
179 134 178 154

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100156145|Ga0070706_1001561452
Length 176
Sequence MATTTSASTAKVPAKGIRVKKISPFLWFDHELEDAMNFYVSTFDNSRVLEVSRDPVGVGGAKGRVFTATFELAGQEFMGLNAGPEFKFNEAVSFFVSCDTQEQVDALWERLTSDGGEESQCGWLKDKFGLSWQIVPRALPEMLQDKDPAKAKRVMDAMLQMKKIDIAGLKRAYDQT

Samples

Sample ID Description Type Environment
1 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
74 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
84 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
89 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
90 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
96 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
97 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
98 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
99 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
122 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
126 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.35
Nodule 0
Rhizoplane 5.59
Rhizosphere 88.27
Stem 0
Stem Tuber 0
Unclassified 2.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10136023 3300003323 Bacteria 2035
2 rootH1_10136024 3300003323 Unclassified 2034
3 Ga0065715_10804536 3300005293 Bacteria 608
4 Ga0065707_10142775 3300005295 Bacteria 1751
5 Ga0070677_10113296 3300005333 Bacteria 1214
6 Ga0070677_10606486 3300005333 Bacteria 607
7 Ga0070692_10029476 3300005345 Bacteria 2736
8 Ga0070692_10331737 3300005345 Unclassified 939
9 Ga0070668_100040268 3300005347 Bacteria 3575
10 Ga0070668_100961444 3300005347 Bacteria 766
11 Ga0070669_100203193 3300005353 Bacteria 1560
12 Ga0070669_100383653 3300005353 Bacteria 1146
13 Ga0070675_101440500 3300005354 Bacteria 635
14 Ga0070674_100825977 3300005356 Bacteria 802
15 Ga0070673_100707726 3300005364 Unclassified 925
16 Ga0070667_100000047 3300005367 Bacteria 160405
17 Ga0070701_10035530 3300005438 Bacteria 2504
18 Ga0070705_100163168 3300005440 Bacteria 1492
19 Ga0070700_100944355 3300005441 Unclassified 705
20 Ga0070694_100116983 3300005444 Bacteria 1908
21 Ga0070662_100536583 3300005457 Bacteria 979
22 Ga0070662_100889939 3300005457 Unclassified 759
23 Ga0068867_100182193 3300005459 Bacteria 1671
24 Ga0070706_100156145 3300005467 Bacteria 2130
25 Ga0070707_100302731 3300005468 Bacteria 1553
26 Ga0070698_100250781 3300005471 Unclassified 1703
27 Ga0070699_100176363 3300005518 Bacteria 1895
28 Ga0070697_102085026 3300005536 Bacteria 508
29 Ga0070672_100120707 3300005543 Bacteria 2145
30 Ga0070686_100152173 3300005544 Bacteria 1621
31 Ga0070686_100156270 3300005544 Bacteria 1602
32 Ga0070686_101274206 3300005544 Bacteria 613
33 Ga0070695_100131171 3300005545 Bacteria 1727
34 Ga0070695_100437389 3300005545 Bacteria 999
35 Ga0070695_101133909 3300005545 Unclassified 641
36 Ga0070696_100394287 3300005546 Bacteria 1082
37 Ga0070696_100473215 3300005546 Bacteria 992
38 Ga0070704_100022590 3300005549 Bacteria 4096
39 Ga0070704_100058567 3300005549 Bacteria 2744
40 Ga0070704_100912591 3300005549 Bacteria 791
41 Ga0070702_100132819 3300005615 Bacteria 1575
42 Ga0068859_100308535 3300005617 Bacteria 1676
43 Ga0068859_100810939 3300005617 Bacteria 1023
44 Ga0068861_100172836 3300005719 Bacteria 1792
45 Ga0068861_100242960 3300005719 Bacteria 1532
46 Ga0068861_100615518 3300005719 Bacteria 999
47 Ga0068858_100743655 3300005842 Unclassified 955
48 Ga0068860_100004570 3300005843 Bacteria 14126
49 Ga0068860_100508523 3300005843 Bacteria 1203
50 Ga0068860_101427290 3300005843 Bacteria 713
51 Ga0068862_100082371 3300005844 Bacteria 2792
52 Ga0075368_10000312 3300006042 Bacteria 14157
53 Ga0075367_10004476 3300006178 Bacteria 6830
54 Ga0075428_100046170 3300006844 Bacteria 4785
55 Ga0075428_101170930 3300006844 Bacteria 811
56 Ga0075434_100763730 3300006871 Bacteria 983
57 Ga0075429_100037691 3300006880 Bacteria 4208
58 Ga0075429_100504893 3300006880 Bacteria 1060
59 Ga0097620_100308532 3300006931 Bacteria 1676
60 Ga0097620_100810998 3300006931 Bacteria 1023
61 Ga0075435_100091286 3300007076 Unclassified 2513
62 Ga0075435_100313376 3300007076 Bacteria 1343
63 Ga0105240_10000102 3300009093 Bacteria 174846
64 Ga0111539_10261647 3300009094 Bacteria 2014
65 Ga0111539_11104612 3300009094 Bacteria 921
66 Ga0114129_10101798 3300009147 Bacteria 3974
67 Ga0114129_11337341 3300009147 Bacteria 886
68 Ga0105243_10194262 3300009148 Bacteria 1775
69 Ga0105238_10519034 3300009551 Bacteria 1194
70 Ga0105249_10397273 3300009553 Bacteria 1408
71 Ga0105239_10655826 3300010375 Bacteria 1199
72 Ga0157374_10073094 3300013296 Bacteria 3237
73 Ga0157374_10752547 3300013296 Bacteria 989
74 Ga0163162_10019571 3300013306 Bacteria 6645
75 Ga0163162_10318711 3300013306 Bacteria 1687
76 Ga0157372_10000157 3300013307 Bacteria 73930
77 Ga0157375_10545419 3300013308 Bacteria 1321
78 Ga0157380_10487529 3300014326 Bacteria 1194
79 Ga0157380_10526157 3300014326 Bacteria 1154
80 Ga0209646_1001314 3300025246 Bacteria 6935
81 Ga0207684_10111304 3300025910 Bacteria 2344
82 Ga0207684_10298733 3300025910 Bacteria 1388
83 Ga0207695_10000109 3300025913 Bacteria 251757
84 Ga0207646_10182702 3300025922 Bacteria 1894
85 Ga0207681_10077973 3300025923 Bacteria 2331
86 Ga0207670_10383158 3300025936 Bacteria 1120
87 Ga0207691_10065762 3300025940 Unclassified 3280
88 Ga0207691_10808309 3300025940 Bacteria 788
89 Ga0207651_10521496 3300025960 Bacteria 1030
90 Ga0207651_10542370 3300025960 Bacteria 1010
91 Ga0207668_10141360 3300025972 Bacteria 1852
92 Ga0207658_10000063 3300025986 Bacteria 118139
93 Ga0207639_10735614 3300026041 Bacteria 917
94 Ga0207708_10696860 3300026075 Unclassified 868
95 Ga0207641_11987550 3300026088 Bacteria 583
96 Ga0207675_100024704 3300026118 Bacteria 5588
97 Ga0207675_100505465 3300026118 Bacteria 1203
98 Ga0209813_10000327 3300027866 Bacteria 12478
99 Ga0268265_10221727 3300028380 Bacteria 1655
100 Ga0268264_10347848 3300028381 Bacteria 1410
101 Ga0307515_10000001 3300028794 Bacteria 4259510
102 Ga0265338_10019228 3300028800 Bacteria 7265
103 Ga0265338_10019929 3300028800 Bacteria 7082
104 Ga0265338_10107849 3300028800 Bacteria 2251
105 Ga0265338_10135691 3300028800 Bacteria 1935
106 Ga0265324_10015439 3300029957 Plasmid 2809
107 Ga0265340_10007562 3300031247 Bacteria 5895
108 Ga0265331_10047920 3300031250 Bacteria 2056
109 Ga0265327_10000190 3300031251 Bacteria 130086
110 Ga0265327_10006498 3300031251 Bacteria 9331
111 Ga0307513_10653045 3300031456 Bacteria 759
112 Ga0265314_10116993 3300031711 Bacteria 1685
113 Ga0265342_10307474 3300031712 Bacteria 834
114 Ga0307413_10140233 3300031824 Bacteria 1669
115 Ga0307412_10920163 3300031911 Bacteria 768
116 Ga0307416_101382447 3300032002 Bacteria 810
117 Ga0373945_0059877 3300035116 Bacteria 1419
118 Ga0373954_0340114 3300035118 Bacteria 741
119 Ga0373931_0314106 3300035691 Bacteria 971
120 Ga0373931_0472873 3300035691 Bacteria 805
121 Ga0373947_0097795 3300035725 Bacteria 1840
122 Ga0395900_0557434 3300037418 Bacteria 1090
123 Ga0451800_1540347 3300041459 Bacteria 1165
124 Ga0451807_2296074 3300041486 Bacteria 584
125 Ga0439443_055249 3300042003 Bacteria 702
126 Ga0451577_1010752 3300042876 Unclassified 746
127 Ga0466963_0004997 3300044694 Bacteria 7742
128 Ga0453684_0001393 3300044712 Bacteria 69974
129 Ga0453684_0009392 3300044712 Bacteria 17122
130 Ga0453684_0082195 3300044712 Bacteria 4014
131 Ga0453684_0702337 3300044712 Unclassified 1099
132 Ga0453684_0966079 3300044712 Unclassified 908
133 Ga0466967_0006850 3300045976 Bacteria 8130
134 Ga0495639_0161454 3300046475 Bacteria 1085
135 Ga0495594_0004719 3300046499 Bacteria 7026
136 Ga0495632_0090735 3300046519 Unclassified 1449
137 Ga0495663_0058102 3300046525 Unclassified 1212
138 Ga0495658_0301292 3300046683 Bacteria 1014
139 Ga0496104_0000175 3300048907 Bacteria 56916
140 Ga0496105_0014060 3300048908 Bacteria 6369
141 Ga0496108_0006491 3300048911 Bacteria 9488
142 Ga0496110_0000549 3300048913 Bacteria 25571
143 Ga0496111_0006678 3300048914 Bacteria 7505
144 Ga0496112_0024306 3300048915 Bacteria 5800
145 Ga0496113_0004354 3300048916 Bacteria 8680
146 Ga0496115_0156424 3300048918 Bacteria 1883
147 Ga0501031_0002442 3300049568 Bacteria 11833
148 Ga0501032_0002958 3300049569 Bacteria 13198
149 Ga0501034_0050360 3300049571 Bacteria 4201
150 Ga0501036_0001666 3300049572 Bacteria 17221
151 Ga0501037_0000031 3300049573 Bacteria 133137
152 Ga0501038_0020252 3300049574 Bacteria 5983
153 Ga0501043_0000366 3300049579 Bacteria 40919
154 Ga0501046_0000138 3300049580 Bacteria 77052
155 Ga0501047_0000032 3300049581 Bacteria 208294
156 Ga0501047_0014763 3300049581 Bacteria 7433
157 Ga0501048_0000013 3300049582 Bacteria 76554
158 Ga0501070_0005575 3300049586 Bacteria 10738
159 Ga0501073_0004842 3300049589 Bacteria 10105
160 Ga0501074_0263902 3300049590 Bacteria 1224
161 Ga0501241_001283 3300049758 Bacteria 5212
162 Ga0501282_018440 3300049778 Bacteria 762
163 Ga0501035_0000799 3300049822 Bacteria 33519
164 Ga0501044_0004435 3300049823 Bacteria 15703
165 Ga0501044_0009238 3300049823 Bacteria 10767
166 nmdc:mga06z11_2382_c1 3300050494 Bacteria 7160
167 nmdc:mga04h51_230_c1 3300050495 Bacteria 14875
168 nmdc:mga05p37_130213_c1 3300050507 Bacteria 2651
169 nmdc:mga05p37_47779_c1 3300050507 Bacteria 5263
170 nmdc:mga09592_92179_c1 3300050508 Bacteria 2590
171 nmdc:mga06r32_1172066_c1 3300050510 Bacteria 715
172 nmdc:mga06r32_506342_c1 3300050510 Bacteria 1184
173 nmdc:mga06r32_529093_c1 3300050510 Unclassified 1154
174 nmdc:mga08y16_216165_c1 3300050511 Bacteria 1985
175 nmdc:mga0n895_870766_c1 3300050512 Bacteria 888
176 nmdc:mga0rr50_588140_c1 3300050513 Bacteria 949
177 Ga0500628_031449 3300053129 Bacteria 1155
178 Ga0501082_0164582 3300060353 Bacteria 1927

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005353 Ga0070669_100383653 Ga0070669_1003836531 121
2 3300005543 Ga0070672_100120707 Ga0070672_1001207072 121
3 3300005617 Ga0068859_100308535 Ga0068859_1003085354 121
4 3300006931 Ga0097620_100308532 Ga0097620_1003085324 121
5 3300005347 Ga0070668_100961444 Ga0070668_1009614441 125
6 3300035691 Ga0373931_0314106 Ga0373931_0314106_124_525 133
7 3300046519 Ga0495632_0090735 Ga0495632_0090735_237_638 133
8 3300048907 Ga0496104_0000175 Ga0496104_0000175_50175_50603 134
9 3300048908 Ga0496105_0014060 Ga0496105_0014060_4620_5048 134
10 3300048911 Ga0496108_0006491 Ga0496108_0006491_4739_5167 134
11 3300048913 Ga0496110_0000549 Ga0496110_0000549_5687_6115 134
12 3300048914 Ga0496111_0006678 Ga0496111_0006678_6565_6993 134
13 3300048915 Ga0496112_0024306 Ga0496112_0024306_2726_3154 134
14 3300048916 Ga0496113_0004354 Ga0496113_0004354_4642_5070 134
15 iso_pu_bacteria 2873151551 2873158259 135
16 3300031251 Ga0265327_10006498 Ga0265327_1000649811 138
17 3300032002 Ga0307416_101382447 Ga0307416_1013824472 138
18 3300048918 Ga0496115_0156424 Ga0496115_0156424_725_1198 138
19 3300005345 Ga0070692_10029476 Ga0070692_100294763 139
20 3300005345 Ga0070692_10331737 Ga0070692_103317371 139
21 3300005347 Ga0070668_100040268 Ga0070668_1000402685 139
22 3300005356 Ga0070674_100825977 Ga0070674_1008259771 139
23 3300005364 Ga0070673_100707726 Ga0070673_1007077262 139
24 3300005438 Ga0070701_10035530 Ga0070701_100355303 139
25 3300005440 Ga0070705_100163168 Ga0070705_1001631683 139
26 3300005444 Ga0070694_100116983 Ga0070694_1001169832 139
27 3300005457 Ga0070662_100536583 Ga0070662_1005365833 139
28 3300005457 Ga0070662_100889939 Ga0070662_1008899392 139
29 3300005459 Ga0068867_100182193 Ga0068867_1001821932 139
30 3300005468 Ga0070707_100302731 Ga0070707_1003027312 139
31 3300005518 Ga0070699_100176363 Ga0070699_1001763632 139
32 3300005536 Ga0070697_102085026 Ga0070697_1020850261 139
33 3300005544 Ga0070686_100156270 Ga0070686_1001562701 139
34 3300005544 Ga0070686_101274206 Ga0070686_1012742061 139
35 3300005545 Ga0070695_100131171 Ga0070695_1001311712 139
36 3300005545 Ga0070695_100437389 Ga0070695_1004373892 139
37 3300005546 Ga0070696_100394287 Ga0070696_1003942871 139
38 3300005549 Ga0070704_100022590 Ga0070704_1000225901 139
39 3300005549 Ga0070704_100058567 Ga0070704_1000585674 139
40 3300005615 Ga0070702_100132819 Ga0070702_1001328192 139
41 3300005617 Ga0068859_100810939 Ga0068859_1008109393 139
42 3300005719 Ga0068861_100172836 Ga0068861_1001728363 139
43 3300005719 Ga0068861_100242960 Ga0068861_1002429602 139
44 3300005842 Ga0068858_100743655 Ga0068858_1007436551 139
45 3300005843 Ga0068860_100004570 Ga0068860_10000457016 139
46 3300005843 Ga0068860_101427290 Ga0068860_1014272901 139
47 3300005844 Ga0068862_100082371 Ga0068862_1000823712 139
48 3300006042 Ga0075368_10000312 Ga0075368_1000031215 139
49 3300006178 Ga0075367_10004476 Ga0075367_100044768 139
50 3300006871 Ga0075434_100763730 Ga0075434_1007637302 139
51 3300006880 Ga0075429_100504893 Ga0075429_1005048932 139
52 3300006931 Ga0097620_100810998 Ga0097620_1008109983 139
53 3300007076 Ga0075435_100091286 Ga0075435_1000912862 139
54 3300007076 Ga0075435_100313376 Ga0075435_1003133762 139
55 3300009093 Ga0105240_10000102 Ga0105240_10000102172 139
56 3300009094 Ga0111539_11104612 Ga0111539_111046121 139
57 3300009147 Ga0114129_11337341 Ga0114129_113373411 139
58 3300009148 Ga0105243_10194262 Ga0105243_101942621 139
59 3300009553 Ga0105249_10397273 Ga0105249_103972732 139
60 3300013306 Ga0163162_10019571 Ga0163162_100195713 139
61 3300013308 Ga0157375_10545419 Ga0157375_105454192 139
62 3300025910 Ga0207684_10298733 Ga0207684_102987331 139
63 3300025913 Ga0207695_10000109 Ga0207695_1000010992 139
64 3300025922 Ga0207646_10182702 Ga0207646_101827021 139
65 3300025936 Ga0207670_10383158 Ga0207670_103831582 139
66 3300025940 Ga0207691_10065762 Ga0207691_100657623 139
67 3300025960 Ga0207651_10521496 Ga0207651_105214962 139
68 3300025960 Ga0207651_10542370 Ga0207651_105423701 139
69 3300025972 Ga0207668_10141360 Ga0207668_101413603 139
70 3300026118 Ga0207675_100024704 Ga0207675_1000247043 139
71 3300026118 Ga0207675_100505465 Ga0207675_1005054652 139
72 3300027866 Ga0209813_10000327 Ga0209813_1000032711 139
73 3300028380 Ga0268265_10221727 Ga0268265_102217271 139
74 3300028800 Ga0265338_10107849 Ga0265338_101078492 139
75 3300028800 Ga0265338_10135691 Ga0265338_101356912 139
76 3300029957 Ga0265324_10015439 Ga0265324_100154393 139
77 3300031712 Ga0265342_10307474 Ga0265342_103074742 139
78 3300031824 Ga0307413_10140233 Ga0307413_101402332 139
79 3300035116 Ga0373945_0059877 Ga0373945_0059877_748_1218 139
80 3300035725 Ga0373947_0097795 Ga0373947_0097795_1026_1496 139
81 3300044694 Ga0466963_0004997 Ga0466963_0004997_1663_2118 139
82 3300044712 Ga0453684_0009392 Ga0453684_0009392_16360_16866 139
83 3300045976 Ga0466967_0006850 Ga0466967_0006850_2364_2819 139
84 3300046525 Ga0495663_0058102 Ga0495663_0058102_573_1043 139
85 3300046683 Ga0495658_0301292 Ga0495658_0301292_257_733 139
86 3300049568 Ga0501031_0002442 Ga0501031_0002442_1815_2300 139
87 3300049569 Ga0501032_0002958 Ga0501032_0002958_9943_10428 139
88 3300049571 Ga0501034_0050360 Ga0501034_0050360_414_899 139
89 3300049572 Ga0501036_0001666 Ga0501036_0001666_10411_10896 139
90 3300049573 Ga0501037_0000031 Ga0501037_0000031_122179_122664 139
91 3300049574 Ga0501038_0020252 Ga0501038_0020252_2774_3259 139
92 3300049579 Ga0501043_0000366 Ga0501043_0000366_3285_3770 139
93 3300049580 Ga0501046_0000138 Ga0501046_0000138_10647_11132 139
94 3300049581 Ga0501047_0000032 Ga0501047_0000032_27759_28244 139
95 3300049582 Ga0501048_0000013 Ga0501048_0000013_35346_35831 139
96 3300049586 Ga0501070_0005575 Ga0501070_0005575_8443_8928 139
97 3300049589 Ga0501073_0004842 Ga0501073_0004842_8231_8716 139
98 3300049590 Ga0501074_0263902 Ga0501074_0263902_394_879 139
99 3300049778 Ga0501282_018440 Ga0501282_018440_250_726 139
100 3300049822 Ga0501035_0000799 Ga0501035_0000799_16820_17305 139
101 3300050494 nmdc:mga06z11_2382_c1 nmdc:mga06z11_2382_c1_2907_3338 139
102 3300050495 nmdc:mga04h51_230_c1 nmdc:mga04h51_230_c1_6205_6636 139
103 3300050507 nmdc:mga05p37_130213_c1 nmdc:mga05p37_130213_c1_1215_1688 139
104 3300050512 nmdc:mga0n895_870766_c1 nmdc:mga0n895_870766_c1_370_843 139
105 3300050513 nmdc:mga0rr50_588140_c1 nmdc:mga0rr50_588140_c1_411_884 139
106 3300060353 Ga0501082_0164582 Ga0501082_0164582_408_893 139
107 3300005293 Ga0065715_10804536 Ga0065715_108045361 140
108 3300005295 Ga0065707_10142775 Ga0065707_101427753 140
109 3300005333 Ga0070677_10113296 Ga0070677_101132962 140
110 3300005333 Ga0070677_10606486 Ga0070677_106064861 140
111 3300005353 Ga0070669_100203193 Ga0070669_1002031932 140
112 3300005441 Ga0070700_100944355 Ga0070700_1009443551 140
113 3300005471 Ga0070698_100250781 Ga0070698_1002507812 140
114 3300005544 Ga0070686_100152173 Ga0070686_1001521732 140
115 3300005545 Ga0070695_101133909 Ga0070695_1011339091 140
116 3300005546 Ga0070696_100473215 Ga0070696_1004732151 140
117 3300005549 Ga0070704_100912591 Ga0070704_1009125911 140
118 3300005719 Ga0068861_100615518 Ga0068861_1006155182 140
119 3300006844 Ga0075428_100046170 Ga0075428_1000461704 140
120 3300006844 Ga0075428_101170930 Ga0075428_1011709302 140
121 3300006880 Ga0075429_100037691 Ga0075429_1000376916 140
122 3300009147 Ga0114129_10101798 Ga0114129_101017981 140
123 3300009551 Ga0105238_10519034 Ga0105238_105190342 140
124 3300010375 Ga0105239_10655826 Ga0105239_106558261 140
125 3300013296 Ga0157374_10073094 Ga0157374_100730944 140
126 3300013296 Ga0157374_10752547 Ga0157374_107525471 140
127 3300013306 Ga0163162_10318711 Ga0163162_103187112 140
128 3300014326 Ga0157380_10487529 Ga0157380_104875292 140
129 3300014326 Ga0157380_10526157 Ga0157380_105261571 140
130 3300025923 Ga0207681_10077973 Ga0207681_100779732 140
131 3300025940 Ga0207691_10808309 Ga0207691_108083091 140
132 3300026075 Ga0207708_10696860 Ga0207708_106968602 140
133 3300026088 Ga0207641_11987550 Ga0207641_119875501 140
134 3300028800 Ga0265338_10019228 Ga0265338_100192283 140
135 3300028800 Ga0265338_10019929 Ga0265338_100199296 140
136 3300031247 Ga0265340_10007562 Ga0265340_100075623 140
137 3300031250 Ga0265331_10047920 Ga0265331_100479202 140
138 3300031251 Ga0265327_10000190 Ga0265327_1000019030 140
139 3300031711 Ga0265314_10116993 Ga0265314_101169931 140
140 3300031911 Ga0307412_10920163 Ga0307412_109201632 140
141 3300035118 Ga0373954_0340114 Ga0373954_0340114_55_570 140
142 3300035691 Ga0373931_0472873 Ga0373931_0472873_10_525 140
143 3300041459 Ga0451800_1540347 Ga0451800_1540347_396_857 140
144 3300041486 Ga0451807_2296074 Ga0451807_2296074_10_450 140
145 3300042003 Ga0439443_055249 Ga0439443_055249_199_684 140
146 3300042876 Ga0451577_1010752 Ga0451577_1010752_118_579 140
147 3300044712 Ga0453684_0001393 Ga0453684_0001393_29218_29679 140
148 3300044712 Ga0453684_0082195 Ga0453684_0082195_3115_3657 140
149 3300044712 Ga0453684_0702337 Ga0453684_0702337_327_785 140
150 3300044712 Ga0453684_0966079 Ga0453684_0966079_228_803 140
151 3300046475 Ga0495639_0161454 Ga0495639_0161454_101_616 140
152 3300046499 Ga0495594_0004719 Ga0495594_0004719_696_1211 140
153 3300049758 Ga0501241_001283 Ga0501241_001283_3182_3670 140
154 3300049823 Ga0501044_0009238 Ga0501044_0009238_7873_8346 140
155 3300050507 nmdc:mga05p37_47779_c1 nmdc:mga05p37_47779_c1_2877_3335 140
156 3300050508 nmdc:mga09592_92179_c1 nmdc:mga09592_92179_c1_647_1105 140
157 3300050510 nmdc:mga06r32_1172066_c1 nmdc:mga06r32_1172066_c1_51_548 140
158 3300050510 nmdc:mga06r32_506342_c1 nmdc:mga06r32_506342_c1_105_596 140
159 3300050510 nmdc:mga06r32_529093_c1 nmdc:mga06r32_529093_c1_656_1114 140
160 3300053129 Ga0500628_031449 Ga0500628_031449_514_954 140
161 3300003323 rootH1_10136023 rootH1_101360232 141
162 3300003323 rootH1_10136024 rootH1_101360242 141
163 3300005354 Ga0070675_101440500 Ga0070675_1014405001 141
164 3300005367 Ga0070667_100000047 Ga0070667_10000004757 141
165 3300005467 Ga0070706_100156145 Ga0070706_1001561452 141
166 3300005843 Ga0068860_100508523 Ga0068860_1005085232 141
167 3300009094 Ga0111539_10261647 Ga0111539_102616472 141
168 3300013307 Ga0157372_10000157 Ga0157372_1000015750 141
169 3300025246 Ga0209646_1001314 Ga0209646_10013148 141
170 3300025910 Ga0207684_10111304 Ga0207684_101113042 141
171 3300025986 Ga0207658_10000063 Ga0207658_1000006317 141
172 3300026041 Ga0207639_10735614 Ga0207639_107356142 141
173 3300028381 Ga0268264_10347848 Ga0268264_103478482 141
174 3300028794 Ga0307515_10000001 Ga0307515_10000001827 141
175 3300031456 Ga0307513_10653045 Ga0307513_106530452 141
176 3300037418 Ga0395900_0557434 Ga0395900_0557434_388_897 141
177 3300049581 Ga0501047_0014763 Ga0501047_0014763_4428_4928 141
178 3300049823 Ga0501044_0004435 Ga0501044_0004435_10843_11343 141
179 3300050511 nmdc:mga08y16_216165_c1 nmdc:mga08y16_216165_c1_913_1380 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

20

135

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9058 1 140
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9055 1 140
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.8937 1 140
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.8934 1 140
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.8933 1 140
ID Description Score Start End Superfamily
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8741 1 140 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8624 1 140 3.10.180.10
af_Q54TE8_621_846_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8119 64 84 3.40.50.300
af_O13996_392_488_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7755 27 54 2.60.40.1180
af_P9WLN7_64_211_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7652 87 107 3.50.50.60
ID Description Score Start End GO Terms
AF-S4MYN5-F1-model_v4 PhnB-like domain-containing protein 0.987 67 140
AF-A0A4Q3SJL7-F1-model_v4 deleted 0.9819 76 141
AF-A0A1W2DT34-F1-model_v4 Glyoxalase superfamily enzyme, possibly 3-demethylubiquinone-9 3-methyltransferase 0.9804 1 141 GO:0008168
GO:0032259
AF-A0A7K1TTW2-F1-model_v4 VOC family protein 0.9728 2 140
AF-A0A6J6MUK7-F1-model_v4 Unannotated protein 0.9724 2 140

Feature Viewer

pLDDT pTM Quality
95.02 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map