F273250

General Info

Members Datasets Scaffolds Average Seq Length
179 135 179 179

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100057152|Ga0070680_1000571522
Length 204
Sequence VAPATRSKTLFVGTQRGLLNDAMHPLLDLQPTLRGELLELRPLRADDFEALFAVASDRLIWEQHFAPDRFREDVFRQFFRDAARSGGALVALDRRDGRVIGSSRFQWHDQPPDELEIGWSFLARSHWGGRYNGEMKRLMLHHAFAMVDRVVFLVTPGNRRSQRALEKIGAVRAGTRCTSAGREAIVFEITRSLHDAIHGDAHAK

Samples

Sample ID Description Type Environment
1 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
52 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
95 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
96 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
97 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
102 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
103 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
128 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.61
Nodule 0
Rhizoplane 3.35
Rhizosphere 84.92
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c004780 3300000043 Bacteria 1267
2 JGI25153J46596_10006464 3300003215 Bacteria 5915
3 rootH1_10190749 3300003323 Bacteria 1079
4 Ga0055537_1000787 3300003773 Bacteria 15930
5 Ga0055524_1000387 3300003775 Bacteria 37906
6 Ga0055528_1018821 3300003790 Bacteria 2322
7 Ga0055530_10016653 3300003791 Bacteria 2336
8 Ga0055531_10007996 3300003794 Bacteria 5656
9 Ga0055543_1052220 3300004625 Bacteria 668
10 Ga0065165_1036160 3300005262 Bacteria 1509
11 Ga0065707_10113652 3300005295 Bacteria 2321
12 Ga0070683_100000357 3300005329 Bacteria 31582
13 Ga0070680_100057152 3300005336 Unclassified 3189
14 Ga0070680_100212501 3300005336 Bacteria 1632
15 Ga0070680_100824172 3300005336 Bacteria 800
16 Ga0070659_100085604 3300005366 Bacteria 2521
17 Ga0070709_10000863 3300005434 Bacteria 16941
18 Ga0070713_100516111 3300005436 Bacteria 1129
19 Ga0070710_10579946 3300005437 Bacteria 778
20 Ga0070705_100467718 3300005440 Unclassified 950
21 Ga0070681_10009481 3300005458 Bacteria 9580
22 Ga0070698_100670892 3300005471 Unclassified 978
23 Ga0070679_100006127 3300005530 Bacteria 11186
24 Ga0070679_100265612 3300005530 Unclassified 1671
25 Ga0070684_100004914 3300005535 Bacteria 10199
26 Ga0070697_100884968 3300005536 Bacteria 792
27 Ga0070695_100245663 3300005545 Unclassified 1300
28 Ga0070696_100168265 3300005546 Bacteria 1619
29 Ga0070693_100495459 3300005547 Bacteria 866
30 Ga0070665_100113063 3300005548 Bacteria 2718
31 Ga0068855_100959697 3300005563 Bacteria 900
32 Ga0068856_100423876 3300005614 Bacteria 1351
33 Ga0068856_100891825 3300005614 Bacteria 908
34 Ga0068852_100037897 3300005616 Bacteria 4047
35 Ga0068859_100037939 3300005617 Bacteria 4835
36 Ga0068858_100004402 3300005842 Bacteria 13818
37 Ga0075362_10100782 3300006177 Bacteria 1350
38 Ga0075431_100128716 3300006847 Bacteria 2612
39 Ga0075431_100668823 3300006847 Bacteria 1018
40 Ga0075434_100038624 3300006871 Bacteria 4728
41 Ga0075434_100060181 3300006871 Unclassified 3777
42 Ga0075436_100070856 3300006914 Bacteria 2410
43 Ga0075436_100451909 3300006914 Bacteria 936
44 Ga0097620_100037938 3300006931 Bacteria 4835
45 Ga0105240_10001786 3300009093 Bacteria 36277
46 Ga0114129_10410153 3300009147 Unclassified 1784
47 Ga0105243_11378065 3300009148 Bacteria 725
48 Ga0105248_10020124 3300009177 Bacteria 7394
49 Ga0105239_10447144 3300010375 Archaea 1466
50 Ga0157370_10016393 3300013104 Bacteria 7500
51 Ga0157378_10357596 3300013297 Bacteria 1428
52 Ga0163162_10470487 3300013306 Unclassified 1388
53 Ga0157372_10001194 3300013307 Bacteria 28111
54 Ga0157372_10386174 3300013307 Bacteria 1631
55 Ga0163163_10370426 3300014325 Unclassified 1489
56 Ga0157380_10045300 3300014326 Unclassified 3451
57 Ga0157380_10359445 3300014326 Bacteria 1365
58 Ga0157379_10014675 3300014968 Bacteria 6872
59 Ga0157379_10150512 3300014968 Bacteria 2099
60 Ga0209436_114381 3300025208 Bacteria 1261
61 Ga0207425_1027943 3300025245 Bacteria 1147
62 Ga0209565_1000029 3300025263 Bacteria 340335
63 Ga0209673_1004556 3300025273 Bacteria 7363
64 Ga0209564_1037050 3300025295 Bacteria 1381
65 Ga0209758_1002578 3300025297 Bacteria 18191
66 Ga0209256_1000008 3300025299 Bacteria 975723
67 Ga0209257_1002893 3300025304 Bacteria 15944
68 Ga0207699_10002973 3300025906 Bacteria 8058
69 Ga0207699_10029712 3300025906 Unclassified 3050
70 Ga0207707_10000783 3300025912 Bacteria 31161
71 Ga0207695_10009435 3300025913 Bacteria 12070
72 Ga0207660_10015889 3300025917 Bacteria 4976
73 Ga0207660_10880300 3300025917 Bacteria 731
74 Ga0207652_10025442 3300025921 Unclassified 4921
75 Ga0207652_10392631 3300025921 Unclassified 1252
76 Ga0207646_11398217 3300025922 Bacteria 609
77 Ga0207700_10272146 3300025928 Unclassified 1454
78 Ga0207690_10025060 3300025932 Bacteria 3742
79 Ga0207709_10671946 3300025935 Bacteria 826
80 Ga0207670_10062004 3300025936 Bacteria 2554
81 Ga0207665_10001346 3300025939 Bacteria 16559
82 Ga0207665_10494520 3300025939 Bacteria 944
83 Ga0207661_10000188 3300025944 Bacteria 40047
84 Ga0207703_10003357 3300026035 Bacteria 13443
85 Ga0207702_10594152 3300026078 Bacteria 1086
86 Ga0207676_10862229 3300026095 Bacteria 886
87 Ga0207676_11012072 3300026095 Unclassified 819
88 Ga0207674_10568264 3300026116 Unclassified 1095
89 Ga0207698_10070113 3300026142 Bacteria 2776
90 Ga0207698_11051357 3300026142 Viruses 826
91 Ga0268266_10287615 3300028379 Bacteria 1530
92 Ga0265338_10011935 3300028800 Bacteria 9964
93 Ga0265340_10038342 3300031247 Bacteria 2370
94 Ga0265339_10008025 3300031249 Bacteria 6753
95 Ga0265316_10031613 3300031344 Unclassified 4326
96 Ga0307408_100159080 3300031548 Bacteria 1792
97 Ga0265314_10002682 3300031711 Bacteria 17834
98 Ga0265314_10010851 3300031711 Bacteria 7571
99 Ga0265342_10113488 3300031712 Bacteria 1531
100 Ga0265342_10224704 3300031712 Bacteria 1010
101 Ga0307405_10182131 3300031731 Bacteria 1509
102 Ga0307413_10007304 3300031824 Bacteria 5120
103 Ga0307413_10024693 3300031824 Bacteria 3281
104 Ga0307413_10172089 3300031824 Bacteria 1534
105 Ga0307410_10035046 3300031852 Bacteria 3256
106 Ga0307410_10051844 3300031852 Bacteria 2768
107 Ga0307410_10074014 3300031852 Unclassified 2371
108 Ga0307410_10476997 3300031852 Bacteria 1022
109 Ga0307410_10978848 3300031852 Bacteria 728
110 Ga0307406_10148085 3300031901 Bacteria 1671
111 Ga0307406_10292813 3300031901 Unclassified 1247
112 Ga0307407_10092471 3300031903 Bacteria 1858
113 Ga0307412_10785410 3300031911 Bacteria 825
114 Ga0307412_11459848 3300031911 Unclassified 621
115 Ga0307409_100102557 3300031995 Bacteria 2377
116 Ga0307409_100163048 3300031995 Bacteria 1952
117 Ga0307416_100130356 3300032002 Bacteria 2262
118 Ga0307416_100567322 3300032002 Bacteria 1210
119 Ga0307416_100768431 3300032002 Bacteria 1057
120 Ga0307416_100821204 3300032002 Unclassified 1026
121 Ga0307414_10086889 3300032004 Bacteria 2309
122 Ga0307414_10189587 3300032004 Bacteria 1662
123 Ga0307414_10827299 3300032004 Unclassified 846
124 Ga0307411_10012438 3300032005 Bacteria 4644
125 Ga0307411_10046555 3300032005 Bacteria 2797
126 Ga0307411_10083661 3300032005 Bacteria 2205
127 Ga0307411_10572099 3300032005 Bacteria 967
128 Ga0307415_100070259 3300032126 Bacteria 2458
129 Ga0373959_0044413 3300034820 Bacteria 943
130 Ga0373934_0000435 3300035086 Bacteria 14563
131 Ga0373940_0103742 3300035088 Bacteria 866
132 Ga0373941_0033386 3300035115 Bacteria 1546
133 Ga0373953_0000900 3300035117 Bacteria 8322
134 Ga0373956_0081376 3300035119 Unclassified 1486
135 Ga0373957_0013436 3300035120 Bacteria 2778
136 Ga0373960_0073859 3300035121 Bacteria 1060
137 Ga0373942_0068593 3300035207 Bacteria 1031
138 Ga0373961_0009475 3300035241 Bacteria 2384
139 Ga0373933_0014535 3300035724 Bacteria 4380
140 Ga0373937_0000232 3300036401 Bacteria 54273
141 Ga0436364_1440639 3300037853 Unclassified 3478
142 Ga0450898_014949 3300042134 Bacteria 1310
143 Ga0450898_032543 3300042134 Bacteria 962
144 Ga0451577_0001751 3300042876 Bacteria 27985
145 Ga0451577_0136486 3300042876 Bacteria 2203
146 Ga0451577_0215368 3300042876 Bacteria 1735
147 Ga0451577_0702127 3300042876 Bacteria 916
148 Ga0453683_0020855 3300044673 Bacteria 4186
149 Ga0453683_0027116 3300044673 Bacteria 3637
150 Ga0453684_0000801 3300044712 Bacteria 107237
151 Ga0451576_0001797 3300045051 Bacteria 35108
152 Ga0451576_0986841 3300045051 Unclassified 883
153 Ga0495651_0022115 3300046462 Bacteria 4944
154 Ga0495587_0263801 3300046536 Unclassified 967
155 Ga0495621_0189049 3300046539 Unclassified 825
156 Ga0496101_0444607 3300048904 Bacteria 1023
157 Ga0496102_0771146 3300048905 Bacteria 884
158 Ga0496106_0428508 3300048909 Bacteria 1063
159 Ga0496109_0318848 3300048912 Bacteria 1467
160 Ga0496112_0003705 3300048915 Bacteria 12753
161 Ga0496113_0248694 3300048916 Bacteria 1419
162 Ga0501031_0118624 3300049568 Bacteria 1729
163 Ga0501034_0113690 3300049571 Bacteria 2696
164 Ga0501040_0436835 3300049576 Bacteria 942
165 Ga0501072_0367642 3300049588 Bacteria 1142
166 Ga0501074_0324669 3300049590 Bacteria 1093
167 Ga0501074_0438013 3300049590 Bacteria 927
168 Ga0501076_0495570 3300049592 Bacteria 1007
169 Ga0501076_0635255 3300049592 Bacteria 881
170 Ga0501076_0863139 3300049592 Bacteria 746
171 Ga0501077_0341387 3300049593 Bacteria 955
172 nmdc:mga03683_195285_c1 3300050489 Bacteria 927
173 nmdc:mga05p37_595295_c1 3300050507 Unclassified 1249
174 nmdc:mga0n895_14527_c1 3300050512 Bacteria 7155
175 nmdc:mga08x19_99782_c1 3300050514 Bacteria 1925
176 nmdc:mga0a205_476805_c1 3300050515 Unclassified 1106
177 Ga0500562_026043 3300053108 Bacteria 1532
178 Ga0501082_0608947 3300060353 Bacteria 956
179 Ga0530510_0083698 3300061734 Bacteria 2323

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025922 Ga0207646_11398217 Ga0207646_113982171 155
2 3300031824 Ga0307413_10007304 Ga0307413_100073043 158
3 3300031852 Ga0307410_10035046 Ga0307410_100350466 158
4 3300032005 Ga0307411_10012438 Ga0307411_100124384 158
5 3300009147 Ga0114129_10410153 Ga0114129_104101531 165
6 3300026142 Ga0207698_11051357 Ga0207698_110513571 165
7 3300050507 nmdc:mga05p37_595295_c1 nmdc:mga05p37_595295_c1_61_564 165
8 3300050515 nmdc:mga0a205_476805_c1 nmdc:mga0a205_476805_c1_42_545 165
9 3300003323 rootH1_10190749 rootH1_101907492 166
10 3300005336 Ga0070680_100824172 Ga0070680_1008241721 166
11 3300025917 Ga0207660_10880300 Ga0207660_108803001 166
12 3300031247 Ga0265340_10038342 Ga0265340_100383422 166
13 3300031711 Ga0265314_10002682 Ga0265314_1000268213 166
14 3300031712 Ga0265342_10113488 Ga0265342_101134883 166
15 3300031852 Ga0307410_10051844 Ga0307410_100518442 167
16 3300032004 Ga0307414_10086889 Ga0307414_100868891 167
17 3300042134 Ga0450898_032543 Ga0450898_032543_169_672 167
18 3300042876 Ga0451577_0001751 Ga0451577_0001751_20473_21000 167
19 3300044673 Ga0453683_0020855 Ga0453683_0020855_3014_3541 167
20 3300044712 Ga0453684_0000801 Ga0453684_0000801_91406_91933 167
21 3300045051 Ga0451576_0001797 Ga0451576_0001797_23571_24098 167
22 3300031548 Ga0307408_100159080 Ga0307408_1001590802 168
23 3300031824 Ga0307413_10172089 Ga0307413_101720892 168
24 3300031852 Ga0307410_10476997 Ga0307410_104769972 168
25 3300031852 Ga0307410_10978848 Ga0307410_109788482 168
26 3300032002 Ga0307416_100567322 Ga0307416_1005673222 168
27 3300032005 Ga0307411_10083661 Ga0307411_100836613 168
28 3300032005 Ga0307411_10572099 Ga0307411_105720992 168
29 3300042134 Ga0450898_014949 Ga0450898_014949_564_1070 168
30 3300042876 Ga0451577_0136486 Ga0451577_0136486_1083_1622 168
31 3300005563 Ga0068855_100959697 Ga0068855_1009596972 169
32 3300005614 Ga0068856_100423876 Ga0068856_1004238761 169
33 3300006847 Ga0075431_100128716 Ga0075431_1001287161 169
34 3300006871 Ga0075434_100038624 Ga0075434_1000386244 169
35 3300006914 Ga0075436_100070856 Ga0075436_1000708563 169
36 3300006914 Ga0075436_100451909 Ga0075436_1004519091 169
37 3300014326 Ga0157380_10359445 Ga0157380_103594451 169
38 3300025906 Ga0207699_10029712 Ga0207699_100297122 169
39 3300025939 Ga0207665_10001346 Ga0207665_100013466 169
40 3300026078 Ga0207702_10594152 Ga0207702_105941522 169
41 3300031731 Ga0307405_10182131 Ga0307405_101821312 169
42 3300031824 Ga0307413_10024693 Ga0307413_100246934 169
43 3300031995 Ga0307409_100102557 Ga0307409_1001025573 169
44 3300032002 Ga0307416_100130356 Ga0307416_1001303562 169
45 3300032002 Ga0307416_100768431 Ga0307416_1007684312 169
46 3300032004 Ga0307414_10189587 Ga0307414_101895873 169
47 3300032005 Ga0307411_10046555 Ga0307411_100465553 169
48 3300032126 Ga0307415_100070259 Ga0307415_1000702594 169
49 3300034820 Ga0373959_0044413 Ga0373959_0044413_264_827 169
50 3300035088 Ga0373940_0103742 Ga0373940_0103742_230_793 169
51 3300035115 Ga0373941_0033386 Ga0373941_0033386_792_1355 169
52 3300035121 Ga0373960_0073859 Ga0373960_0073859_357_920 169
53 3300035207 Ga0373942_0068593 Ga0373942_0068593_185_748 169
54 3300035241 Ga0373961_0009475 Ga0373961_0009475_517_1080 169
55 3300042876 Ga0451577_0215368 Ga0451577_0215368_1145_1675 169
56 3300042876 Ga0451577_0702127 Ga0451577_0702127_98_628 169
57 3300048915 Ga0496112_0003705 Ga0496112_0003705_7986_8549 169
58 3300048916 Ga0496113_0248694 Ga0496113_0248694_318_881 169
59 3300049571 Ga0501034_0113690 Ga0501034_0113690_884_1399 169
60 3300049592 Ga0501076_0495570 Ga0501076_0495570_134_649 169
61 3300049592 Ga0501076_0635255 Ga0501076_0635255_262_777 169
62 3300049592 Ga0501076_0863139 Ga0501076_0863139_144_662 169
63 3300050512 nmdc:mga0n895_14527_c1 nmdc:mga0n895_14527_c1_3933_4496 169
64 3300050514 nmdc:mga08x19_99782_c1 nmdc:mga08x19_99782_c1_629_1192 169
65 3300060353 Ga0501082_0608947 Ga0501082_0608947_394_909 169
66 3300005329 Ga0070683_100000357 Ga0070683_1000003578 170
67 3300005336 Ga0070680_100057152 Ga0070680_1000571522 170
68 3300005336 Ga0070680_100212501 Ga0070680_1002125012 170
69 3300005366 Ga0070659_100085604 Ga0070659_1000856042 170
70 3300005434 Ga0070709_10000863 Ga0070709_100008637 170
71 3300005436 Ga0070713_100516111 Ga0070713_1005161112 170
72 3300005437 Ga0070710_10579946 Ga0070710_105799461 170
73 3300005458 Ga0070681_10009481 Ga0070681_100094819 170
74 3300005530 Ga0070679_100006127 Ga0070679_1000061276 170
75 3300005535 Ga0070684_100004914 Ga0070684_1000049144 170
76 3300005536 Ga0070697_100884968 Ga0070697_1008849682 170
77 3300005546 Ga0070696_100168265 Ga0070696_1001682652 170
78 3300005548 Ga0070665_100113063 Ga0070665_1001130632 170
79 3300005614 Ga0068856_100891825 Ga0068856_1008918252 170
80 3300005616 Ga0068852_100037897 Ga0068852_1000378973 170
81 3300005617 Ga0068859_100037939 Ga0068859_1000379393 170
82 3300005842 Ga0068858_100004402 Ga0068858_1000044027 170
83 3300006177 Ga0075362_10100782 Ga0075362_101007822 170
84 3300006847 Ga0075431_100668823 Ga0075431_1006688232 170
85 3300006871 Ga0075434_100060181 Ga0075434_1000601814 170
86 3300006931 Ga0097620_100037938 Ga0097620_1000379383 170
87 3300009093 Ga0105240_10001786 Ga0105240_1000178613 170
88 3300009177 Ga0105248_10020124 Ga0105248_100201243 170
89 3300010375 Ga0105239_10447144 Ga0105239_104471443 170
90 3300013104 Ga0157370_10016393 Ga0157370_100163932 170
91 3300013306 Ga0163162_10470487 Ga0163162_104704872 170
92 3300013307 Ga0157372_10001194 Ga0157372_100011944 170
93 3300013307 Ga0157372_10386174 Ga0157372_103861742 170
94 3300014325 Ga0163163_10370426 Ga0163163_103704262 170
95 3300014326 Ga0157380_10045300 Ga0157380_100453003 170
96 3300014968 Ga0157379_10014675 Ga0157379_100146755 170
97 3300014968 Ga0157379_10150512 Ga0157379_101505123 170
98 3300025906 Ga0207699_10002973 Ga0207699_100029734 170
99 3300025912 Ga0207707_10000783 Ga0207707_1000078311 170
100 3300025913 Ga0207695_10009435 Ga0207695_100094353 170
101 3300025917 Ga0207660_10015889 Ga0207660_100158893 170
102 3300025921 Ga0207652_10025442 Ga0207652_100254423 170
103 3300025928 Ga0207700_10272146 Ga0207700_102721461 170
104 3300025932 Ga0207690_10025060 Ga0207690_100250603 170
105 3300025936 Ga0207670_10062004 Ga0207670_100620042 170
106 3300025944 Ga0207661_10000188 Ga0207661_1000018826 170
107 3300026035 Ga0207703_10003357 Ga0207703_100033578 170
108 3300026095 Ga0207676_10862229 Ga0207676_108622292 170
109 3300026116 Ga0207674_10568264 Ga0207674_105682642 170
110 3300026142 Ga0207698_10070113 Ga0207698_100701132 170
111 3300028379 Ga0268266_10287615 Ga0268266_102876152 170
112 3300028800 Ga0265338_10011935 Ga0265338_100119354 170
113 3300031249 Ga0265339_10008025 Ga0265339_100080257 170
114 3300031344 Ga0265316_10031613 Ga0265316_100316135 170
115 3300031711 Ga0265314_10010851 Ga0265314_100108514 170
116 3300031712 Ga0265342_10224704 Ga0265342_102247042 170
117 3300031852 Ga0307410_10074014 Ga0307410_100740143 170
118 3300031901 Ga0307406_10148085 Ga0307406_101480851 170
119 3300031901 Ga0307406_10292813 Ga0307406_102928132 170
120 3300031903 Ga0307407_10092471 Ga0307407_100924712 170
121 3300031911 Ga0307412_10785410 Ga0307412_107854101 170
122 3300031995 Ga0307409_100163048 Ga0307409_1001630483 170
123 3300032004 Ga0307414_10827299 Ga0307414_108272992 170
124 3300035086 Ga0373934_0000435 Ga0373934_0000435_4600_5127 170
125 3300035117 Ga0373953_0000900 Ga0373953_0000900_571_1098 170
126 3300035119 Ga0373956_0081376 Ga0373956_0081376_259_786 170
127 3300035120 Ga0373957_0013436 Ga0373957_0013436_124_651 170
128 3300035724 Ga0373933_0014535 Ga0373933_0014535_2578_3105 170
129 3300036401 Ga0373937_0000232 Ga0373937_0000232_14207_14734 170
130 3300037853 Ga0436364_1440639 Ga0436364_1440639_811_1347 170
131 3300044673 Ga0453683_0027116 Ga0453683_0027116_709_1257 170
132 3300045051 Ga0451576_0986841 Ga0451576_0986841_63_593 170
133 3300046462 Ga0495651_0022115 Ga0495651_0022115_4093_4620 170
134 3300046536 Ga0495587_0263801 Ga0495587_0263801_256_783 170
135 3300048904 Ga0496101_0444607 Ga0496101_0444607_458_1000 170
136 3300048905 Ga0496102_0771146 Ga0496102_0771146_241_807 170
137 3300048909 Ga0496106_0428508 Ga0496106_0428508_316_858 170
138 3300048912 Ga0496109_0318848 Ga0496109_0318848_564_1106 170
139 3300049568 Ga0501031_0118624 Ga0501031_0118624_557_1084 170
140 3300049576 Ga0501040_0436835 Ga0501040_0436835_10_537 170
141 3300049588 Ga0501072_0367642 Ga0501072_0367642_151_678 170
142 3300049590 Ga0501074_0324669 Ga0501074_0324669_111_638 170
143 3300049590 Ga0501074_0438013 Ga0501074_0438013_62_589 170
144 3300049593 Ga0501077_0341387 Ga0501077_0341387_260_787 170
145 3300050489 nmdc:mga03683_195285_c1 nmdc:mga03683_195285_c1_228_764 170
146 3300053108 Ga0500562_026043 Ga0500562_026043_648_1199 170
147 3300061734 Ga0530510_0083698 Ga0530510_0083698_1296_1850 170
148 3300005530 Ga0070679_100265612 Ga0070679_1002656122 171
149 3300005545 Ga0070695_100245663 Ga0070695_1002456631 171
150 3300005547 Ga0070693_100495459 Ga0070693_1004954592 171
151 3300013297 Ga0157378_10357596 Ga0157378_103575962 171
152 3300025921 Ga0207652_10392631 Ga0207652_103926312 171
153 3300025939 Ga0207665_10494520 Ga0207665_104945201 171
154 3300031911 Ga0307412_11459848 Ga0307412_114598481 171
155 3300032002 Ga0307416_100821204 Ga0307416_1008212041 171
156 3300005295 Ga0065707_10113652 Ga0065707_101136522 173
157 3300005440 Ga0070705_100467718 Ga0070705_1004677181 173
158 3300005471 Ga0070698_100670892 Ga0070698_1006708922 173
159 3300009148 Ga0105243_11378065 Ga0105243_113780652 173
160 3300025935 Ga0207709_10671946 Ga0207709_106719462 173
161 3300026095 Ga0207676_11012072 Ga0207676_110120722 173
162 3300046539 Ga0495621_0189049 Ga0495621_0189049_75_647 173
163 3300000043 ARcpr5yngRDRAFT_c004780 ARcpr5yngRDRAFT_0047802 174
164 3300003215 JGI25153J46596_10006464 JGI25153J46596_100064646 174
165 3300003773 Ga0055537_1000787 Ga0055537_10007872 174
166 3300003775 Ga0055524_1000387 Ga0055524_100038727 174
167 3300003790 Ga0055528_1018821 Ga0055528_10188213 174
168 3300003791 Ga0055530_10016653 Ga0055530_100166532 174
169 3300003794 Ga0055531_10007996 Ga0055531_100079964 174
170 3300004625 Ga0055543_1052220 Ga0055543_10522201 174
171 3300005262 Ga0065165_1036160 Ga0065165_10361602 174
172 3300025208 Ga0209436_114381 Ga0209436_1143812 174
173 3300025245 Ga0207425_1027943 Ga0207425_10279432 174
174 3300025263 Ga0209565_1000029 Ga0209565_1000029231 174
175 3300025273 Ga0209673_1004556 Ga0209673_100455610 174
176 3300025295 Ga0209564_1037050 Ga0209564_10370502 174
177 3300025297 Ga0209758_1002578 Ga0209758_100257819 174
178 3300025299 Ga0209256_1000008 Ga0209256_1000008839 174
179 3300025304 Ga0209257_1002893 Ga0209257_100289315 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

38

171

0.85

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

42

170

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tcv-assembly1.cif.gz_A crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis 0.8275 4 170
3pzj-assembly1.cif.gz_A crystal structure of a probable acetyltransferases (gnat family) from chromobacterium violaceum atcc 12472 0.81 6 170
8gxk-assembly2.cif.gz_C pseudomonas jinjuensis n-acetyltransferase 0.7991 4 170
8gxj-assembly1.cif.gz_A pseudomonas aeruginosa n-acetyltransferase domain-containing protein pa3270 0.7982 4 170
3tcv-assembly1.cif.gz_A crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis 0.7936 4 170
ID Description Score Start End Superfamily
2fl4A02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.839 62 168 3.40.630.30
3tcvA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8275 4 170 3.40.630.30
af_K7LHF0_767_874_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8204 62 149 3.40.630.30
3tcvA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7936 4 170 3.40.630.30
af_I1KA97_33_154_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.7888 62 80 2.170.150.20
ID Description Score Start End GO Terms
AF-A0A2D8AI59-F1-model_v4 GNAT family N-acetyltransferase 0.9893 3 77
AF-A0A520BTD9-F1-model_v4 N-acetyltransferase 0.9847 1 80 GO:0016740
AF-A0A3L7N3L0-F1-model_v4 GNAT family N-acetyltransferase 0.9788 2 126 GO:0009254
GO:0016747
GO:0016803
GO:0016835
GO:0046348
GO:0097367
AF-A0A4Q3TI75-F1-model_v4 deleted 0.9628 2 121
AF-A0A2V6M590-F1-model_v4 N-acetyltransferase 0.9623 2 126 GO:0016747

Feature Viewer

pLDDT pTM Quality
91.02 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map