F272079

General Info

Members Datasets Scaffolds Average Seq Length
178 137 356 235

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10133038|Ga0157376_101330383
Length 276
Sequence MTAAAIRQRIRTEGTIMTDPRGSSDHPAGDTSALSHGALYRLLAWSSPGYPTGAFSYSHGLEWAVEAGSVTNLQSLLDYLTAVLSRGGGWIDAVLFAQAWRATCRKAEPHAALDDPTASSLPTSLDDLTSLAAAFRGSSETALESRQQGAAFLDVTRKAWPHPTLETFALRSAATNTPVAHCIAAAVACSAHGIALEPALHAYLHTVAANLVSAGARLIPLGQSQAQIAIARLAPTIATVIERALTTSLDDLGTAAPAVELCSLRHETQYTRLFRS

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
39 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
40 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
41 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
43 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
59 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
60 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
65 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
69 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
70 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
71 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
72 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
80 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
81 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
82 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
83 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
84 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
85 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
86 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
98 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
99 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
106 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
107 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
108 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
109 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
121 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
122 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
123 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
128 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
131 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
132 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
133 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
136 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
137 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.55
Nodule 0.56
Rhizoplane 2.81
Rhizosphere 75.84
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10133038 3300014969 Bacteria 2222
2 JGI25159J45721_1000440 3300002987 Bacteria 19136
3 JGI25160J50197_1000624 3300003354 Bacteria 19827
4 JGI25161J50226_1000431 3300003374 Bacteria 19827
5 Ga0055543_1000593 3300004625 Bacteria 19865
6 Ga0065165_1001916 3300005262 Bacteria 19865
7 Ga0070683_100100591 3300005329 Bacteria 2721
8 Ga0070666_10311715 3300005335 Bacteria 1122
9 Ga0070689_100003048 3300005340 Bacteria 11037
10 Ga0070671_100006062 3300005355 Bacteria 9633
11 Ga0070667_100004708 3300005367 Bacteria 11442
12 Ga0070713_100191119 3300005436 Bacteria 1845
13 Ga0070681_10013337 3300005458 Bacteria 8167
14 Ga0070685_10176266 3300005466 Bacteria 1373
15 Ga0070679_100442688 3300005530 Bacteria 1244
16 Ga0070665_100042690 3300005548 Bacteria 4558
17 Ga0070665_100107131 3300005548 Bacteria 2797
18 Ga0068855_100013466 3300005563 Bacteria 9859
19 Ga0068859_100000306 3300005617 Bacteria 48835
20 Ga0068861_100130129 3300005719 Bacteria 2042
21 Ga0068858_100000643 3300005842 Bacteria 36390
22 Ga0068858_100003093 3300005842 Bacteria 16649
23 Ga0068860_100013185 3300005843 Bacteria 8111
24 Ga0081455_10004221 3300005937 Bacteria 16199
25 Ga0075366_10006116 3300006195 Bacteria 6564
26 Ga0068871_100098104 3300006358 Bacteria 2451
27 Ga0075433_10106134 3300006852 Bacteria 2489
28 Ga0075434_100028020 3300006871 Bacteria 5532
29 Ga0075434_100041958 3300006871 Bacteria 4535
30 Ga0097620_100000306 3300006931 Bacteria 48835
31 Ga0075435_100056881 3300007076 Bacteria 3163
32 Ga0105240_10206790 3300009093 Bacteria 2297
33 Ga0105240_10252778 3300009093 Bacteria 2037
34 Ga0105240_10425791 3300009093 Bacteria 1490
35 Ga0105247_10000072 3300009101 Bacteria 113959
36 Ga0105247_10011867 3300009101 Bacteria 5238
37 Ga0105248_10020306 3300009177 Bacteria 7361
38 Ga0105237_10620155 3300009545 Bacteria 1088
39 Ga0105237_10731929 3300009545 Bacteria 995
40 Ga0105238_10081401 3300009551 Bacteria 3227
41 Ga0105238_10224574 3300009551 Bacteria 1855
42 Ga0105249_10025107 3300009553 Bacteria 5363
43 Ga0163162_10208230 3300013306 Bacteria 2085
44 Ga0163163_10908527 3300014325 Bacteria 944
45 Ga0157379_10009332 3300014968 Bacteria 8544
46 Ga0213872_10000472 3300021361 Bacteria 32613
47 Ga0213872_10035449 3300021361 Bacteria 2282
48 Ga0213872_10086954 3300021361 Bacteria 1401
49 Ga0213871_10000813 3300021441 Bacteria 4666
50 Ga0213871_10054124 3300021441 Bacteria 1106
51 Ga0209233_1000722 3300025261 Bacteria 15278
52 Ga0209130_1000288 3300025284 Bacteria 61556
53 Ga0207426_1000481 3300025302 Bacteria 60584
54 Ga0207710_10004250 3300025900 Bacteria 6279
55 Ga0207645_10015104 3300025907 Bacteria 5143
56 Ga0207645_10157386 3300025907 Bacteria 1485
57 Ga0207707_10238198 3300025912 Bacteria 1582
58 Ga0207695_10413320 3300025913 Bacteria 1233
59 Ga0207700_10032396 3300025928 Bacteria 3728
60 Ga0207644_10001263 3300025931 Bacteria 16265
61 Ga0207670_10056402 3300025936 Bacteria 2659
62 Ga0207661_10072432 3300025944 Bacteria 2819
63 Ga0207703_10000405 3300026035 Bacteria 46259
64 Ga0207703_10000535 3300026035 Bacteria 39196
65 Ga0207648_10041026 3300026089 Bacteria 4065
66 Ga0207675_100169748 3300026118 Bacteria 2085
67 Ga0207683_10166078 3300026121 Bacteria 1997
68 Ga0268266_10081550 3300028379 Bacteria 2821
69 Ga0268266_10153279 3300028379 Bacteria 2079
70 Ga0268264_10048005 3300028381 Bacteria 3550
71 Ga0265338_10019141 3300028800 Bacteria 7285
72 Ga0307511_10000045 3300030521 Bacteria 100332
73 Ga0265325_10013096 3300031241 Bacteria 4726
74 Ga0265340_10054563 3300031247 Bacteria 1927
75 Ga0265340_10065869 3300031247 Bacteria 1725
76 Ga0265339_10001793 3300031249 Bacteria 15803
77 Ga0265339_10038417 3300031249 Bacteria 2671
78 Ga0265331_10034167 3300031250 Bacteria 2510
79 Ga0265331_10081554 3300031250 Bacteria 1502
80 Ga0307513_10148639 3300031456 Bacteria 2256
81 Ga0307509_10000115 3300031507 Bacteria 116444
82 Ga0307508_10067642 3300031616 Bacteria 3142
83 Ga0307508_10199243 3300031616 Bacteria 1603
84 Ga0307405_10021739 3300031731 Bacteria 3612
85 Ga0307415_100208849 3300032126 Bacteria 1556
86 Ga0307510_10000012 3300033180 Bacteria 345634
87 Ga0307510_10086906 3300033180 Bacteria 2996
88 Ga0373936_0044241 3300035113 Bacteria 1791
89 Ga0373954_0057919 3300035118 Bacteria 1825
90 Ga0373956_0010147 3300035119 Bacteria 3848
91 Ga0373943_0296355 3300035170 Unclassified 917
92 Ga0373955_0161643 3300035172 Bacteria 1322
93 Ga0373931_0098688 3300035691 Bacteria 1639
94 Ga0373933_0007897 3300035724 Bacteria 5807
95 Ga0373937_0164604 3300036401 Bacteria 2079
96 Ga0395900_0097401 3300037418 Bacteria 3022
97 Ga0395898_0526092 3300037466 Bacteria 1124
98 Ga0436364_0484704 3300037853 Bacteria 2092
99 Ga0436360_0548063 3300039438 Bacteria 3326
100 Ga0436360_1101791 3300039438 Bacteria 2420
101 Ga0436361_0449678 3300039447 Bacteria 2496
102 Ga0436361_0616750 3300039447 Bacteria 6873
103 Ga0436361_0653184 3300039447 Bacteria 36949
104 Ga0436361_1004307 3300039447 Bacteria 1327
105 Ga0436363_0393330 3300039450 Bacteria 2527
106 Ga0436363_1266797 3300039450 Bacteria 12948
107 Ga0436362_1198836 3300039453 Bacteria 1808
108 Ga0439453_0000491 3300041408 Bacteria 4352
109 Ga0439431_0082949 3300041997 Bacteria 866
110 Ga0439451_061014 3300042009 Bacteria 754
111 Ga0466969_0008848 3300044656 Bacteria 5340
112 Ga0466969_0056911 3300044656 Bacteria 1907
113 Ga0466966_0056490 3300044684 Bacteria 2483
114 Ga0466966_0071166 3300044684 Bacteria 2179
115 Ga0466966_0089293 3300044684 Bacteria 1915
116 Ga0466961_0019659 3300044693 Bacteria 4345
117 Ga0466964_0040792 3300044706 Bacteria 1875
118 Ga0466971_0030218 3300044719 Bacteria 2424
119 Ga0466968_0157459 3300044735 Bacteria 1047
120 Ga0466959_0018503 3300045049 Bacteria 5116
121 Ga0466958_0267430 3300045836 Bacteria 1095
122 Ga0495611_0214951 3300046648 Bacteria 895
123 Ga0495625_0211167 3300046660 Bacteria 1276
124 Ga0495671_0190202 3300046692 Bacteria 997
125 Ga0495604_0073957 3300047317 Bacteria 2570
126 Ga0495675_0041456 3300047444 Bacteria 2934
127 Ga0496102_0057879 3300048905 Bacteria 3541
128 Ga0496108_0095352 3300048911 Bacteria 2533
129 Ga0496109_0181725 3300048912 Bacteria 1975
130 Ga0496112_0018489 3300048915 Bacteria 6563
131 Ga0496113_0056110 3300048916 Bacteria 2956
132 Ga0496119_0006399 3300048922 Bacteria 10938
133 Ga0496119_0373062 3300048922 Bacteria 686
134 Ga0496120_0000115 3300048923 Bacteria 136364
135 Ga0496120_0275262 3300048923 Bacteria 780
136 Ga0496121_0010368 3300048924 Bacteria 10525
137 Ga0496121_0131096 3300048924 Bacteria 1876
138 Ga0496125_0000409 3300048928 Bacteria 80451
139 Ga0496125_0008677 3300048928 Bacteria 10587
140 Ga0496126_0004204 3300048929 Bacteria 17345
141 Ga0496126_0010794 3300048929 Bacteria 9534
142 Ga0501033_0171956 3300049570 Bacteria 1556
143 Ga0501036_0043205 3300049572 Bacteria 3816
144 Ga0501038_0316656 3300049574 Bacteria 1221
145 Ga0501038_0405965 3300049574 Bacteria 1053
146 Ga0501039_0186870 3300049575 Bacteria 1630
147 Ga0501041_0184230 3300049577 Bacteria 1307
148 Ga0501042_0369283 3300049578 Bacteria 1038
149 Ga0501072_0216374 3300049588 Bacteria 1527
150 Ga0501072_0413391 3300049588 Bacteria 1070
151 Ga0501073_0077261 3300049589 Bacteria 2317
152 Ga0501073_0090442 3300049589 Bacteria 2127
153 Ga0501073_0132428 3300049589 Bacteria 1728
154 Ga0501073_0140205 3300049589 Bacteria 1675
155 Ga0501076_0327507 3300049592 Bacteria 1257
156 Ga0501080_0392538 3300049742 Bacteria 1249
157 nmdc:mga03683_230232_c1 3300050489 Bacteria 857
158 nmdc:mga03n38_27562_c1 3300050490 Bacteria 2358
159 nmdc:mga00v17_431505_c1 3300050491 Bacteria 856
160 nmdc:mga0k408_110892_c1 3300050493 Bacteria 1622
161 nmdc:mga0k408_7672_c1 3300050493 Bacteria 5764
162 nmdc:mga08y16_192145_c1 3300050511 Bacteria 2117
163 nmdc:mga0n895_171649_c1 3300050512 Bacteria 2201
164 nmdc:mga0rr50_198095_c1 3300050513 Bacteria 1649
165 nmdc:mga0a205_146352_c1 3300050515 Bacteria 2263
166 Ga0495601_0167408 3300053077 Bacteria 1436
167 Ga0495619_0056635 3300053085 Bacteria 2599
168 Ga0500566_0234527 3300053094 Bacteria 903
169 Ga0500593_000226 3300053117 Bacteria 23268
170 Ga0500568_0000002 3300053139 Bacteria 880601
171 Ga0501084_0311827 3300054114 Bacteria 1329
172 Ga0501082_0007311 3300060353 Bacteria 9529
173 Ga0501082_0037694 3300060353 Bacteria 4169
174 Ga0501082_0071314 3300060353 Bacteria 2992
175 Ga0501082_0241448 3300060353 Bacteria 1572
176 Ga0466962_0020894 3300061719 Bacteria 3145
177 2513675797 2513237098 Bacteria 9902361
178 2883357653 2883354860 Bacteria 5865246
179 Ga0157376_10133038
180 JGI25159J45721_1000440
181 JGI25160J50197_1000624
182 JGI25161J50226_1000431
183 Ga0055543_1000593
184 Ga0065165_1001916
185 Ga0070683_100100591
186 Ga0070666_10311715
187 Ga0070689_100003048
188 Ga0070671_100006062
189 Ga0070667_100004708
190 Ga0070713_100191119
191 Ga0070681_10013337
192 Ga0070685_10176266
193 Ga0070679_100442688
194 Ga0070665_100042690
195 Ga0070665_100107131
196 Ga0068855_100013466
197 Ga0068859_100000306
198 Ga0068861_100130129
199 Ga0068858_100000643
200 Ga0068858_100003093
201 Ga0068860_100013185
202 Ga0081455_10004221
203 Ga0075366_10006116
204 Ga0068871_100098104
205 Ga0075433_10106134
206 Ga0075434_100028020
207 Ga0075434_100041958
208 Ga0097620_100000306
209 Ga0075435_100056881
210 Ga0105240_10206790
211 Ga0105240_10252778
212 Ga0105240_10425791
213 Ga0105247_10000072
214 Ga0105247_10011867
215 Ga0105248_10020306
216 Ga0105237_10620155
217 Ga0105237_10731929
218 Ga0105238_10081401
219 Ga0105238_10224574
220 Ga0105249_10025107
221 Ga0163162_10208230
222 Ga0163163_10908527
223 Ga0157379_10009332
224 Ga0213872_10000472
225 Ga0213872_10035449
226 Ga0213872_10086954
227 Ga0213871_10000813
228 Ga0213871_10054124
229 Ga0209233_1000722
230 Ga0209130_1000288
231 Ga0207426_1000481
232 Ga0207710_10004250
233 Ga0207645_10015104
234 Ga0207645_10157386
235 Ga0207707_10238198
236 Ga0207695_10413320
237 Ga0207700_10032396
238 Ga0207644_10001263
239 Ga0207670_10056402
240 Ga0207661_10072432
241 Ga0207703_10000405
242 Ga0207703_10000535
243 Ga0207648_10041026
244 Ga0207675_100169748
245 Ga0207683_10166078
246 Ga0268266_10081550
247 Ga0268266_10153279
248 Ga0268264_10048005
249 Ga0265338_10019141
250 Ga0307511_10000045
251 Ga0265325_10013096
252 Ga0265340_10054563
253 Ga0265340_10065869
254 Ga0265339_10001793
255 Ga0265339_10038417
256 Ga0265331_10034167
257 Ga0265331_10081554
258 Ga0307513_10148639
259 Ga0307509_10000115
260 Ga0307508_10067642
261 Ga0307508_10199243
262 Ga0307405_10021739
263 Ga0307415_100208849
264 Ga0307510_10000012
265 Ga0307510_10086906
266 Ga0373936_0044241
267 Ga0373954_0057919
268 Ga0373956_0010147
269 Ga0373943_0296355
270 Ga0373955_0161643
271 Ga0373931_0098688
272 Ga0373933_0007897
273 Ga0373937_0164604
274 Ga0395900_0097401
275 Ga0395898_0526092
276 Ga0436364_0484704
277 Ga0436360_0548063
278 Ga0436360_1101791
279 Ga0436361_0449678
280 Ga0436361_0616750
281 Ga0436361_0653184
282 Ga0436361_1004307
283 Ga0436363_0393330
284 Ga0436363_1266797
285 Ga0436362_1198836
286 Ga0439453_0000491
287 Ga0439431_0082949
288 Ga0439451_061014
289 Ga0466969_0008848
290 Ga0466969_0056911
291 Ga0466966_0056490
292 Ga0466966_0071166
293 Ga0466966_0089293
294 Ga0466961_0019659
295 Ga0466964_0040792
296 Ga0466971_0030218
297 Ga0466968_0157459
298 Ga0466959_0018503
299 Ga0466958_0267430
300 Ga0495611_0214951
301 Ga0495625_0211167
302 Ga0495671_0190202
303 Ga0495604_0073957
304 Ga0495675_0041456
305 Ga0496102_0057879
306 Ga0496108_0095352
307 Ga0496109_0181725
308 Ga0496112_0018489
309 Ga0496113_0056110
310 Ga0496119_0006399
311 Ga0496119_0373062
312 Ga0496120_0000115
313 Ga0496120_0275262
314 Ga0496121_0010368
315 Ga0496121_0131096
316 Ga0496125_0000409
317 Ga0496125_0008677
318 Ga0496126_0004204
319 Ga0496126_0010794
320 Ga0501033_0171956
321 Ga0501036_0043205
322 Ga0501038_0316656
323 Ga0501038_0405965
324 Ga0501039_0186870
325 Ga0501041_0184230
326 Ga0501042_0369283
327 Ga0501072_0216374
328 Ga0501072_0413391
329 Ga0501073_0077261
330 Ga0501073_0090442
331 Ga0501073_0132428
332 Ga0501073_0140205
333 Ga0501076_0327507
334 Ga0501080_0392538
335 nmdc:mga03683_230232_c1
336 nmdc:mga03n38_27562_c1
337 nmdc:mga00v17_431505_c1
338 nmdc:mga0k408_110892_c1
339 nmdc:mga0k408_7672_c1
340 nmdc:mga08y16_192145_c1
341 nmdc:mga0n895_171649_c1
342 nmdc:mga0rr50_198095_c1
343 nmdc:mga0a205_146352_c1
344 Ga0495601_0167408
345 Ga0495619_0056635
346 Ga0500566_0234527
347 Ga0500593_000226
348 Ga0500568_0000002
349 Ga0501084_0311827
350 Ga0501082_0007311
351 Ga0501082_0037694
352 Ga0501082_0071314
353 Ga0501082_0241448
354 Ga0466962_0020894
355 2513675797
356 2883357653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01730

UreF

UreF

70

234

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cxn-assembly2.cif.gz_C structure of the urease accessory protein uref from helicobacter pylori 0.8976 12 212
4hi0-assembly1.cif.gz_C crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.8958 13 234
6jc4-assembly2.cif.gz_C crystal structure of the urease accessory protein uref from klebsiella pneumoniae 0.8949 9 212
6jc4-assembly2.cif.gz_C crystal structure of the urease accessory protein uref from klebsiella pneumoniae 0.8824 9 212
3o1q-assembly2.cif.gz_B native crystal structure of helicobacter pylori urease accessory protein uref 0.8766 12 212
ID Description Score Start End Superfamily
af_Q2G2K7_3_207_1.10.4190.10 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.9405 11 213 1.10.4190.10
af_Q2G2K7_3_207_1.10.4190.10 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.9274 11 213 1.10.4190.10
3cxnC00 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8787 12 212 1.10.4190.10
3sf5C00 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8748 8 234 1.10.4190.10
3sf5C00 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8571 8 234 1.10.4190.10
ID Description Score Start End GO Terms
AF-W7CIF4-F1-model_v4 deleted 0.9476 13 227
AF-F4PG09-F1-model_v4 Urease accessory protein UreE 0.9444 24 203 GO:0005737
GO:0006457
GO:0016151
GO:0019627
GO:0065003
AF-P42876-F1-model_v4 Urease accessory protein UreF 0.941 11 193 GO:0005737
GO:0016151
AF-A0A160UTC1-F1-model_v4 deleted 0.939 40 236
AF-W7YR69-F1-model_v4 Urease accessory protein UreF 0.9386 36 234 GO:0005737
GO:0016151

Map