F271791

General Info

Members Datasets Scaffolds Average Seq Length
178 120 356 228

Family's Representative Sequence

Representative Sequence 3300006177|Ga0075362_10140563|Ga0075362_101405632
Length 245
Sequence MKTGPFTPLRSGRDDGPAVTLRGTEFCVFDAYGTLFDFNSAVARHRGVIGPKADALADMWRVKQIQYTWLRNSMGAYAPFWQVTGEALDHCLAAHGIADPAIRDKLMKAYLALDPFPEVPAMLDQLKAAGMRMAILSNGNPEMLDPMVATSGLADRFEAVLSVDAAGVFKVAPQGYALVEARCGVKPDKVCFLSSNCWDAHGAAHFGFRTVWINRAGAPDDNLPGTPVAQLKDLSFLPSLLGVPS

Samples

Sample ID Description Type Environment
1 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
50 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
83 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
84 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
99 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
112 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
113 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
114 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
115 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
116 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
117 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
118 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
119 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.79
Nodule 0
Rhizoplane 0.56
Rhizosphere 77.53
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075362_10140563 3300006177 Bacteria 1153
2 Ga0070658_10028386 3300005327 Bacteria 4491
3 Ga0070680_100006251 3300005336 Bacteria 9034
4 Ga0068868_100227119 3300005338 Bacteria 1565
5 Ga0070691_10025534 3300005341 Bacteria 2751
6 Ga0070661_100046378 3300005344 Bacteria 3179
7 Ga0070669_100102426 3300005353 Bacteria 2162
8 Ga0070675_100067119 3300005354 Bacteria 2968
9 Ga0070675_101060207 3300005354 Bacteria 745
10 Ga0070674_100093393 3300005356 Bacteria 2177
11 Ga0070674_100382884 3300005356 Bacteria 1145
12 Ga0070659_100061453 3300005366 Bacteria 2969
13 Ga0070667_100400858 3300005367 Bacteria 1249
14 Ga0070713_100443200 3300005436 Bacteria 1218
15 Ga0070700_100171743 3300005441 Bacteria 1502
16 Ga0070681_10010488 3300005458 Bacteria 9150
17 Ga0070681_10083426 3300005458 Bacteria 3149
18 Ga0070706_100054280 3300005467 Bacteria 3699
19 Ga0070706_100724966 3300005467 Bacteria 922
20 Ga0070698_100001171 3300005471 Bacteria 29108
21 Ga0070699_100352653 3300005518 Bacteria 1325
22 Ga0070679_100004301 3300005530 Bacteria 13144
23 Ga0070695_100052659 3300005545 Bacteria 2616
24 Ga0070665_100230639 3300005548 Bacteria 1851
25 Ga0070665_100274765 3300005548 Bacteria 1687
26 Ga0068855_100038019 3300005563 Bacteria 5721
27 Ga0068855_100188994 3300005563 Bacteria 2324
28 Ga0068855_100424643 3300005563 Bacteria 1453
29 Ga0070664_100013659 3300005564 Bacteria 6618
30 Ga0068857_100034256 3300005577 Bacteria 4491
31 Ga0068856_100054916 3300005614 Bacteria 3930
32 Ga0068852_100880971 3300005616 Bacteria 912
33 Ga0068860_100929005 3300005843 Bacteria 887
34 Ga0081455_10008153 3300005937 Bacteria 10927
35 Ga0081455_10011615 3300005937 Bacteria 8836
36 Ga0081455_10030195 3300005937 Bacteria 4927
37 Ga0081540_1108635 3300005983 Bacteria 1178
38 Ga0081539_10003351 3300005985 Bacteria 19892
39 Ga0081539_10017554 3300005985 Bacteria 5016
40 Ga0075365_10036359 3300006038 Bacteria 3190
41 Ga0075365_10126685 3300006038 Bacteria 1765
42 Ga0075364_10440811 3300006051 Bacteria 890
43 Ga0075432_10061147 3300006058 Bacteria 1341
44 Ga0075362_10001695 3300006177 Bacteria 7145
45 Ga0075362_10141488 3300006177 Bacteria 1150
46 Ga0075367_10234841 3300006178 Bacteria 1148
47 Ga0075369_10002166 3300006186 Bacteria 6941
48 Ga0075369_10010234 3300006186 Bacteria 3667
49 Ga0075369_10165216 3300006186 Bacteria 1015
50 Ga0075370_10080400 3300006353 Bacteria 1873
51 Ga0075370_10164077 3300006353 Bacteria 1304
52 Ga0075370_10338194 3300006353 Bacteria 898
53 Ga0068865_100641167 3300006881 Bacteria 902
54 Ga0105240_10118888 3300009093 Bacteria 3185
55 Ga0105240_10165284 3300009093 Bacteria 2625
56 Ga0111539_11029154 3300009094 Bacteria 957
57 Ga0105241_10091727 3300009174 Bacteria 2398
58 Ga0105241_10349699 3300009174 Bacteria 1283
59 Ga0105237_10547784 3300009545 Bacteria 1163
60 Ga0105238_10294892 3300009551 Bacteria 1605
61 Ga0105249_11059067 3300009553 Bacteria 881
62 Ga0105249_11277535 3300009553 Bacteria 805
63 Ga0105239_10893447 3300010375 Bacteria 1020
64 Ga0157370_10017239 3300013104 Bacteria 7289
65 Ga0157374_10905420 3300013296 Bacteria 900
66 Ga0182008_10108420 3300014497 Bacteria 1375
67 Ga0157376_10220990 3300014969 Bacteria 1754
68 Ga0182006_1145625 3300015261 Bacteria 806
69 Ga0213871_10033614 3300021441 Bacteria 1349
70 Ga0207426_1016529 3300025302 Bacteria 2647
71 Ga0207426_1023312 3300025302 Bacteria 2113
72 Ga0207692_10163737 3300025898 Bacteria 1283
73 Ga0207688_10030383 3300025901 Bacteria 2978
74 Ga0207705_10013722 3300025909 Bacteria 5847
75 Ga0207684_10041546 3300025910 Bacteria 3898
76 Ga0207684_10374403 3300025910 Bacteria 1225
77 Ga0207707_10021890 3300025912 Bacteria 5588
78 Ga0207707_10034859 3300025912 Bacteria 4402
79 Ga0207695_10043144 3300025913 Bacteria 4809
80 Ga0207695_10189517 3300025913 Bacteria 1974
81 Ga0207671_10462388 3300025914 Bacteria 1011
82 Ga0207657_10308651 3300025919 Bacteria 1252
83 Ga0207652_10016789 3300025921 Bacteria 5982
84 Ga0207681_10169905 3300025923 Bacteria 1652
85 Ga0207659_10922807 3300025926 Bacteria 751
86 Ga0207686_10219599 3300025934 Bacteria 1372
87 Ga0207670_10038756 3300025936 Bacteria 3115
88 Ga0207670_10041758 3300025936 Bacteria 3018
89 Ga0207661_10057455 3300025944 Bacteria 3128
90 Ga0207679_10129066 3300025945 Bacteria 2025
91 Ga0207667_10049096 3300025949 Bacteria 4459
92 Ga0207667_10066531 3300025949 Bacteria 3756
93 Ga0207712_10915708 3300025961 Bacteria 775
94 Ga0207677_10344222 3300026023 Bacteria 1247
95 Ga0207677_10781405 3300026023 Bacteria 853
96 Ga0207703_10420537 3300026035 Bacteria 1243
97 Ga0207703_11166712 3300026035 Bacteria 740
98 Ga0207639_10183862 3300026041 Bacteria 1780
99 Ga0207702_10033399 3300026078 Bacteria 4297
100 Ga0207702_10105681 3300026078 Bacteria 2494
101 Ga0207674_10041896 3300026116 Bacteria 4733
102 Ga0207698_10084661 3300026142 Bacteria 2571
103 Ga0268266_10011541 3300028379 Bacteria 7672
104 Ga0268266_10133525 3300028379 Bacteria 2222
105 Ga0268266_10498610 3300028379 Bacteria 1162
106 Ga0268264_10448455 3300028381 Bacteria 1249
107 Ga0268264_10653573 3300028381 Bacteria 1041
108 Ga0265334_10046216 3300028573 Bacteria 1683
109 Ga0265318_10031660 3300028577 Bacteria 2050
110 Ga0265332_10052090 3300031238 Bacteria 1758
111 Ga0265320_10039678 3300031240 Bacteria 2352
112 Ga0265340_10015568 3300031247 Bacteria 3951
113 Ga0307415_100400484 3300032126 Bacteria 1172
114 Ga0373932_0008383 3300035112 Bacteria 2471
115 Ga0373939_0124455 3300035114 Bacteria 913
116 Ga0373945_0061970 3300035116 Bacteria 1398
117 Ga0373945_0134676 3300035116 Bacteria 992
118 Ga0373931_0077793 3300035691 Bacteria 1824
119 Ga0373927_0246770 3300035695 Bacteria 1174
120 Ga0395899_0014212 3300037312 Bacteria 6075
121 Ga0395899_0106926 3300037312 Bacteria 2014
122 Ga0395900_0010027 3300037418 Bacteria 9694
123 Ga0395900_0116857 3300037418 Bacteria 2737
124 Ga0395898_0032056 3300037466 Bacteria 5245
125 Ga0395898_0084664 3300037466 Bacteria 3056
126 Ga0395901_0000475 3300038443 Bacteria 46590
127 Ga0395901_0077133 3300038443 Bacteria 3478
128 Ga0395901_0102846 3300038443 Bacteria 2997
129 Ga0395901_0135205 3300038443 Bacteria 2591
130 Ga0436360_0467044 3300039438 Bacteria 14377
131 Ga0436361_0659949 3300039447 Bacteria 3034
132 Ga0451577_0079290 3300042876 Bacteria 2928
133 Ga0451577_0118558 3300042876 Bacteria 2370
134 Ga0453684_0240415 3300044712 Bacteria 2084
135 Ga0453684_0522815 3300044712 Bacteria 1311
136 Ga0451576_0197370 3300045051 Bacteria 2102
137 Ga0495614_0231723 3300048089 Bacteria 842
138 Ga0496112_0712936 3300048915 Bacteria 931
139 Ga0496119_0189143 3300048922 Bacteria 1074
140 Ga0496126_0080156 3300048929 Bacteria 2889
141 Ga0501034_0006395 3300049571 Bacteria 12687
142 Ga0501034_0007238 3300049571 Bacteria 11843
143 Ga0501034_0177125 3300049571 Bacteria 2098
144 Ga0501039_0040650 3300049575 Bacteria 3589
145 Ga0501043_0101993 3300049579 Bacteria 2256
146 Ga0501043_0217523 3300049579 Bacteria 1479
147 Ga0501046_0243455 3300049580 Bacteria 1326
148 Ga0501068_0011001 3300049584 Bacteria 5091
149 Ga0501072_0263460 3300049588 Unclassified 1372
150 Ga0501077_0065786 3300049593 Bacteria 2299
151 Ga0501079_0022760 3300049741 Bacteria 4809
152 Ga0501080_0467817 3300049742 Bacteria 1129
153 Ga0501035_0471718 3300049822 Unclassified 1036
154 Ga0501044_0090781 3300049823 Bacteria 3082
155 Ga0501044_0402428 3300049823 Bacteria 1281
156 nmdc:mga03683_10450_c1 3300050489 Bacteria 3328
157 nmdc:mga03683_121628_c1 3300050489 Bacteria 1161
158 nmdc:mga03683_2177_c1 3300050489 Bacteria 6046
159 nmdc:mga03683_305954_c1 3300050489 Bacteria 746
160 nmdc:mga03683_62332_c1 3300050489 Bacteria 1579
161 nmdc:mga0yw44_47460_c1 3300050492 Bacteria 2585
162 nmdc:mga0yw44_585698_c1 3300050492 Bacteria 758
163 nmdc:mga0k408_8120_c1 3300050493 Bacteria 5624
164 nmdc:mga0k408_88011_c1 3300050493 Bacteria 1824
165 nmdc:mga06z11_34909_c1 3300050494 Bacteria 2471
166 nmdc:mga07m45_123445_c1 3300050496 Bacteria 1496
167 nmdc:mga07m45_141494_c1 3300050496 Bacteria 1393
168 nmdc:mga07m45_321163_c1 3300050496 Bacteria 900
169 nmdc:mga07m45_71907_c1 3300050496 Bacteria 1968
170 nmdc:mga0sz30_28453_c1 3300050516 Bacteria 2301
171 nmdc:mga0sz30_88032_c1 3300050516 Bacteria 1349
172 nmdc:mga0sz30_98649_c1 3300050516 Bacteria 1275
173 Ga0500651_0183482 3300053093 Bacteria 1241
174 Ga0500651_0184474 3300053093 Bacteria 1238
175 Ga0500651_0371781 3300053093 Bacteria 808
176 Ga0500641_0015879 3300053096 Bacteria 2800
177 Ga0500616_0003831 3300053153 Bacteria 11126
178 Ga0501082_0005044 3300060353 Bacteria 11516
179 Ga0075362_10140563
180 Ga0070658_10028386
181 Ga0070680_100006251
182 Ga0068868_100227119
183 Ga0070691_10025534
184 Ga0070661_100046378
185 Ga0070669_100102426
186 Ga0070675_100067119
187 Ga0070675_101060207
188 Ga0070674_100093393
189 Ga0070674_100382884
190 Ga0070659_100061453
191 Ga0070667_100400858
192 Ga0070713_100443200
193 Ga0070700_100171743
194 Ga0070681_10010488
195 Ga0070681_10083426
196 Ga0070706_100054280
197 Ga0070706_100724966
198 Ga0070698_100001171
199 Ga0070699_100352653
200 Ga0070679_100004301
201 Ga0070695_100052659
202 Ga0070665_100230639
203 Ga0070665_100274765
204 Ga0068855_100038019
205 Ga0068855_100188994
206 Ga0068855_100424643
207 Ga0070664_100013659
208 Ga0068857_100034256
209 Ga0068856_100054916
210 Ga0068852_100880971
211 Ga0068860_100929005
212 Ga0081455_10008153
213 Ga0081455_10011615
214 Ga0081455_10030195
215 Ga0081540_1108635
216 Ga0081539_10003351
217 Ga0081539_10017554
218 Ga0075365_10036359
219 Ga0075365_10126685
220 Ga0075364_10440811
221 Ga0075432_10061147
222 Ga0075362_10001695
223 Ga0075362_10141488
224 Ga0075367_10234841
225 Ga0075369_10002166
226 Ga0075369_10010234
227 Ga0075369_10165216
228 Ga0075370_10080400
229 Ga0075370_10164077
230 Ga0075370_10338194
231 Ga0068865_100641167
232 Ga0105240_10118888
233 Ga0105240_10165284
234 Ga0111539_11029154
235 Ga0105241_10091727
236 Ga0105241_10349699
237 Ga0105237_10547784
238 Ga0105238_10294892
239 Ga0105249_11059067
240 Ga0105249_11277535
241 Ga0105239_10893447
242 Ga0157370_10017239
243 Ga0157374_10905420
244 Ga0182008_10108420
245 Ga0157376_10220990
246 Ga0182006_1145625
247 Ga0213871_10033614
248 Ga0207426_1016529
249 Ga0207426_1023312
250 Ga0207692_10163737
251 Ga0207688_10030383
252 Ga0207705_10013722
253 Ga0207684_10041546
254 Ga0207684_10374403
255 Ga0207707_10021890
256 Ga0207707_10034859
257 Ga0207695_10043144
258 Ga0207695_10189517
259 Ga0207671_10462388
260 Ga0207657_10308651
261 Ga0207652_10016789
262 Ga0207681_10169905
263 Ga0207659_10922807
264 Ga0207686_10219599
265 Ga0207670_10038756
266 Ga0207670_10041758
267 Ga0207661_10057455
268 Ga0207679_10129066
269 Ga0207667_10049096
270 Ga0207667_10066531
271 Ga0207712_10915708
272 Ga0207677_10344222
273 Ga0207677_10781405
274 Ga0207703_10420537
275 Ga0207703_11166712
276 Ga0207639_10183862
277 Ga0207702_10033399
278 Ga0207702_10105681
279 Ga0207674_10041896
280 Ga0207698_10084661
281 Ga0268266_10011541
282 Ga0268266_10133525
283 Ga0268266_10498610
284 Ga0268264_10448455
285 Ga0268264_10653573
286 Ga0265334_10046216
287 Ga0265318_10031660
288 Ga0265332_10052090
289 Ga0265320_10039678
290 Ga0265340_10015568
291 Ga0307415_100400484
292 Ga0373932_0008383
293 Ga0373939_0124455
294 Ga0373945_0061970
295 Ga0373945_0134676
296 Ga0373931_0077793
297 Ga0373927_0246770
298 Ga0395899_0014212
299 Ga0395899_0106926
300 Ga0395900_0010027
301 Ga0395900_0116857
302 Ga0395898_0032056
303 Ga0395898_0084664
304 Ga0395901_0000475
305 Ga0395901_0077133
306 Ga0395901_0102846
307 Ga0395901_0135205
308 Ga0436360_0467044
309 Ga0436361_0659949
310 Ga0451577_0079290
311 Ga0451577_0118558
312 Ga0453684_0240415
313 Ga0453684_0522815
314 Ga0451576_0197370
315 Ga0495614_0231723
316 Ga0496112_0712936
317 Ga0496119_0189143
318 Ga0496126_0080156
319 Ga0501034_0006395
320 Ga0501034_0007238
321 Ga0501034_0177125
322 Ga0501039_0040650
323 Ga0501043_0101993
324 Ga0501043_0217523
325 Ga0501046_0243455
326 Ga0501068_0011001
327 Ga0501072_0263460
328 Ga0501077_0065786
329 Ga0501079_0022760
330 Ga0501080_0467817
331 Ga0501035_0471718
332 Ga0501044_0090781
333 Ga0501044_0402428
334 nmdc:mga03683_10450_c1
335 nmdc:mga03683_121628_c1
336 nmdc:mga03683_2177_c1
337 nmdc:mga03683_305954_c1
338 nmdc:mga03683_62332_c1
339 nmdc:mga0yw44_47460_c1
340 nmdc:mga0yw44_585698_c1
341 nmdc:mga0k408_8120_c1
342 nmdc:mga0k408_88011_c1
343 nmdc:mga06z11_34909_c1
344 nmdc:mga07m45_123445_c1
345 nmdc:mga07m45_141494_c1
346 nmdc:mga07m45_321163_c1
347 nmdc:mga07m45_71907_c1
348 nmdc:mga0sz30_28453_c1
349 nmdc:mga0sz30_88032_c1
350 nmdc:mga0sz30_98649_c1
351 Ga0500651_0183482
352 Ga0500651_0184474
353 Ga0500651_0371781
354 Ga0500641_0015879
355 Ga0500616_0003831
356 Ga0501082_0005044

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

84

213

0.94

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

24

207

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2no4-assembly1.cif.gz_B crystal structure analysis of a dehalogenase 0.9756 6 223
2no5-assembly1.cif.gz_B crystal structure analysis of a dehalogenase with intermediate complex 0.9708 7 225
3umb-assembly1.cif.gz_A-2 crystal structure of the l-2-haloacid dehalogenase rsc1362 0.9659 8 226
1zrm-assembly1.cif.gz_A crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate 0.9625 8 221
3um9-assembly1.cif.gz_B crystal structure of the defluorinating l-2-haloacid dehalogenase bpro0530 0.961 8 223
ID Description Score Start End Superfamily
2no5B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9881 23 94 1.10.150.240
1zrmA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9691 8 221 3.40.50.1000
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9639 97 225 3.40.50.1000
3umbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9367 8 224 3.40.50.1000
2no5B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9366 23 94 1.10.150.240
ID Description Score Start End GO Terms
AF-A0A521LRB4-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) 0.9929 3 228 GO:0018784
AF-A0A3D6DUS8-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) 0.9855 5 201 GO:0018784
AF-A0A2S6QGY9-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) 0.9846 7 221 GO:0018784
AF-A0A521LRB4-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) 0.9842 3 228 GO:0018784
AF-A0A2D7KY00-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) 0.9826 8 221 GO:0018784

Map