F271656

General Info

Members Datasets Scaffolds Average Seq Length
178 115 356 599

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100052581|Ga0070695_1000525812
Length 676
Sequence MKQAHPKGPETIEPGTFRLGYISLLAGLVGVAAGFIAYILYDLIGLFTNLSYYHTWSFHFRSPEGNTLGYWVILIPVVGGLIVGFMAKYGSDKIKGHGIPEAMEAVLTTRSRIEAKVAILKPLSAAIAIGTGGPFGAEGPIIQTGGALGSLVGQFIATTASERKVLLACGAGAGMAATFNTPIAGVILAIELLLFEFRARSFIPLVIATTLATSVRWFLLGQHSMFSMDPHVLFDPIHGLPYYLLLGVICGFAAVGFTKFLYWVEDLFDHLPLDDLWHPAIGAFFLGVIGFFIPRVLGVGYDTISDILHNNLALKVLVLLMVFKALALVVSLGSGTSGGLLAPMFMSSAALGGVFAMIINHFLPGAHLSPGAYALVAMGAVFGAAARATFALIVFAFEITRDYNSVLPLMITCVIADMIALHYLPSSIMTEKLTRRGLTVPTDFEVGVLQVVKVSEVMRTDVHSIPPQMTVGELAERMGREEPGFNMTQGLPICDPDGKLVGIVTQGDLLRALKLDPSGKIKVLDAGAQSLVVAYPDERAFDALYRMLNNNIGRLPVVSRDGSKKLVGYLNRSSILSAWTRQIEDESLREHGWLDAILRTDEYQKSAQRCILVGKIAGLTQTKIELDVTTEGNVQRFDFKLAAPQPGIAVGDVVKVSFLEEADGRIVQRIDELRAR

Samples

Sample ID Description Type Environment
1 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
80 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
81 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
82 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
88 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
98 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
99 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
103 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
111 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
112 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
113 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
114 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
115 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0.56
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 2.25
Rhizosphere 96.63
Stem 0
Stem Tuber 0
Unclassified 9.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070695_100052581 3300005545 Bacteria 2618
2 Ga0070683_100040042 3300005329 Bacteria 4306
3 Ga0070683_100049290 3300005329 Bacteria 3895
4 Ga0070690_100027420 3300005330 Unclassified 3521
5 Ga0070680_100061481 3300005336 Bacteria 3074
6 Ga0068868_100001829 3300005338 Bacteria 14624
7 Ga0068868_100033010 3300005338 Bacteria 3987
8 Ga0070671_100064632 3300005355 Bacteria 3047
9 Ga0070673_100061018 3300005364 Bacteria 2990
10 Ga0070709_10012809 3300005434 Bacteria 4700
11 Ga0070709_10017070 3300005434 Bacteria 4155
12 Ga0070714_100000856 3300005435 Bacteria 21568
13 Ga0070714_100001854 3300005435 Bacteria 15388
14 Ga0070714_100004177 3300005435 Bacteria 10870
15 Ga0070713_100007656 3300005436 Bacteria 7601
16 Ga0070713_100022051 3300005436 Bacteria 4914
17 Ga0070710_10001253 3300005437 Bacteria 12049
18 Ga0070710_10053926 3300005437 Bacteria 2267
19 Ga0070711_100011042 3300005439 Bacteria 5602
20 Ga0070700_100026146 3300005441 Bacteria 3444
21 Ga0070681_10001774 3300005458 Bacteria 19357
22 Ga0070681_10015331 3300005458 Bacteria 7625
23 Ga0070698_100061026 3300005471 Unclassified 3803
24 Ga0070679_100022341 3300005530 Bacteria 6184
25 Ga0068853_100026930 3300005539 Bacteria 4831
26 Ga0070695_100016986 3300005545 Bacteria 4412
27 Ga0068855_100000731 3300005563 Bacteria 40322
28 Ga0068855_100005009 3300005563 Bacteria 16169
29 Ga0068855_100105234 3300005563 Unclassified 3244
30 Ga0070664_100000087 3300005564 Bacteria 58652
31 Ga0068857_100000022 3300005577 Bacteria 87864
32 Ga0068857_100006309 3300005577 Bacteria 10151
33 Ga0068856_100000739 3300005614 Bacteria 35433
34 Ga0068856_100003505 3300005614 Bacteria 15839
35 Ga0068856_100015872 3300005614 Bacteria 7283
36 Ga0068864_100000346 3300005618 Bacteria 40844
37 Ga0068863_100009860 3300005841 Bacteria 9307
38 Ga0068858_100000464 3300005842 Bacteria 42303
39 Ga0068860_100000347 3300005843 Bacteria 62207
40 Ga0081539_10032659 3300005985 Unclassified 3184
41 Ga0070717_10000012 3300006028 Bacteria 230311
42 Ga0070717_10002335 3300006028 Bacteria 13354
43 Ga0070717_10003586 3300006028 Bacteria 11129
44 Ga0070716_100054869 3300006173 Bacteria 2278
45 Ga0070712_100014025 3300006175 Bacteria 5136
46 Ga0070712_100023632 3300006175 Bacteria 4063
47 Ga0097621_100000373 3300006237 Bacteria 31139
48 Ga0097621_100001580 3300006237 Bacteria 15592
49 Ga0068871_100000052 3300006358 Bacteria 64030
50 Ga0068871_100001454 3300006358 Bacteria 15839
51 Ga0068865_100004197 3300006881 Bacteria 8683
52 Ga0068865_100004711 3300006881 Bacteria 8239
53 Ga0075436_100032645 3300006914 Unclassified 3588
54 Ga0075435_100024560 3300007076 Bacteria 4680
55 Ga0105240_10007121 3300009093 Bacteria 16294
56 Ga0105240_10071377 3300009093 Bacteria 4295
57 Ga0105240_10104443 3300009093 Bacteria 3441
58 Ga0105240_10201447 3300009093 Bacteria 2332
59 Ga0105247_10009107 3300009101 Bacteria 6042
60 Ga0105242_10041916 3300009176 Bacteria 3694
61 Ga0105248_10110064 3300009177 Unclassified 3106
62 Ga0105238_10000289 3300009551 Bacteria 55836
63 Ga0105249_10103971 3300009553 Bacteria 2676
64 Ga0157369_10000243 3300013105 Bacteria 75602
65 Ga0157369_10000300 3300013105 Bacteria 66166
66 Ga0157369_10128911 3300013105 Bacteria 2681
67 Ga0157374_10000592 3300013296 Bacteria 32031
68 Ga0157374_10002897 3300013296 Bacteria 14386
69 Ga0157374_10020630 3300013296 Bacteria 5852
70 Ga0157378_10000060 3300013297 Bacteria 95816
71 Ga0157378_10000401 3300013297 Bacteria 42628
72 Ga0163162_10012586 3300013306 Bacteria 8262
73 Ga0157372_10000478 3300013307 Bacteria 44164
74 Ga0157372_10000515 3300013307 Bacteria 42626
75 Ga0157372_10000528 3300013307 Bacteria 42366
76 Ga0157372_10001520 3300013307 Bacteria 25216
77 Ga0157372_10041513 3300013307 Bacteria 5087
78 Ga0157372_10123765 3300013307 Unclassified 2973
79 Ga0163163_10028053 3300014325 Bacteria 5401
80 Ga0163163_10039610 3300014325 Bacteria 4600
81 Ga0163163_10058238 3300014325 Bacteria 3820
82 Ga0228598_1004048 3300024227 Bacteria 3119
83 Ga0207692_10041591 3300025898 Bacteria 2277
84 Ga0207699_10014745 3300025906 Bacteria 4040
85 Ga0207699_10028592 3300025906 Bacteria 3100
86 Ga0207699_10041985 3300025906 Bacteria 2646
87 Ga0207684_10058150 3300025910 Bacteria 3281
88 Ga0207707_10005175 3300025912 Bacteria 11431
89 Ga0207707_10040550 3300025912 Unclassified 4067
90 Ga0207695_10061305 3300025913 Unclassified 3888
91 Ga0207695_10072819 3300025913 Unclassified 3503
92 Ga0207695_10076492 3300025913 Bacteria 3402
93 Ga0207695_10149754 3300025913 Bacteria 2273
94 Ga0207693_10011641 3300025915 Bacteria 7116
95 Ga0207693_10027314 3300025915 Bacteria 4512
96 Ga0207693_10029438 3300025915 Bacteria 4337
97 Ga0207663_10054369 3300025916 Bacteria 2507
98 Ga0207652_10005076 3300025921 Bacteria 10682
99 Ga0207694_10008264 3300025924 Bacteria 7868
100 Ga0207694_10072651 3300025924 Unclassified 2690
101 Ga0207650_10001063 3300025925 Bacteria 20425
102 Ga0207700_10005442 3300025928 Bacteria 7623
103 Ga0207700_10017580 3300025928 Bacteria 4782
104 Ga0207664_10009850 3300025929 Bacteria 6725
105 Ga0207686_10037141 3300025934 Bacteria 2938
106 Ga0207665_10018750 3300025939 Bacteria 4547
107 Ga0207665_10020916 3300025939 Unclassified 4301
108 Ga0207661_10053572 3300025944 Bacteria 3229
109 Ga0207679_10001484 3300025945 Bacteria 14693
110 Ga0207667_10000252 3300025949 Bacteria 75421
111 Ga0207667_10000509 3300025949 Bacteria 51354
112 Ga0207667_10005045 3300025949 Bacteria 16122
113 Ga0207640_10002391 3300025981 Bacteria 10040
114 Ga0207677_10001513 3300026023 Bacteria 12275
115 Ga0207703_10001699 3300026035 Bacteria 19791
116 Ga0207702_10000120 3300026078 Bacteria 91853
117 Ga0207702_10000375 3300026078 Bacteria 50994
118 Ga0207702_10012907 3300026078 Bacteria 6948
119 Ga0207702_10019841 3300026078 Bacteria 5567
120 Ga0207641_10012819 3300026088 Bacteria 6872
121 Ga0207676_10015732 3300026095 Bacteria 5467
122 Ga0207674_10000056 3300026116 Bacteria 113265
123 Ga0207674_10004301 3300026116 Bacteria 17174
124 Ga0207674_10023157 3300026116 Bacteria 6659
125 Ga0207683_10028266 3300026121 Bacteria 4848
126 Ga0209974_10004103 3300027876 Bacteria 5205
127 Ga0268264_10002883 3300028381 Bacteria 14959
128 Ga0265319_1003979 3300028563 Bacteria 7496
129 Ga0265319_1019203 3300028563 Bacteria 2558
130 Ga0265338_10002606 3300028800 Bacteria 26655
131 Ga0265338_10008987 3300028800 Bacteria 12017
132 Ga0265338_10021353 3300028800 Bacteria 6756
133 Ga0265338_10110456 3300028800 Bacteria 2216
134 Ga0265760_10000691 3300031090 Bacteria 9619
135 Ga0265320_10002332 3300031240 Bacteria 13318
136 Ga0265320_10006837 3300031240 Bacteria 7145
137 Ga0265325_10002267 3300031241 Bacteria 13042
138 Ga0373926_0013744 3300035083 Bacteria 2748
139 Ga0373931_0042791 3300035691 Unclassified 2382
140 Ga0373933_0043241 3300035724 Bacteria 2665
141 Ga0373947_0006150 3300035725 Bacteria 6983
142 Ga0373925_0006139 3300037068 Bacteria 8874
143 Ga0373925_0008774 3300037068 Bacteria 7364
144 Ga0395905_0000026 3300037471 Bacteria 315051
145 Ga0395905_0060243 3300037471 Bacteria 3550
146 Ga0436361_0719406 3300039447 Bacteria 12107
147 Ga0436362_0045904 3300039453 Unclassified 3003
148 Ga0451577_0075544 3300042876 Bacteria 3004
149 Ga0466965_0015074 3300044683 Bacteria 3669
150 Ga0466963_0004031 3300044694 Bacteria 8496
151 Ga0466964_0049792 3300044706 Bacteria 1716
152 Ga0453684_0131385 3300044712 Bacteria 3003
153 Ga0451576_0072124 3300045051 Bacteria 3594
154 Ga0495651_0108504 3300046462 Bacteria 2056
155 Ga0495580_0000228 3300046472 Bacteria 43816
156 Ga0495580_0029745 3300046472 Bacteria 3962
157 Ga0495580_0037584 3300046472 Bacteria 3472
158 Ga0495664_0020615 3300046477 Bacteria 3803
159 Ga0495665_0000347 3300046531 Bacteria 23337
160 Ga0495645_0016369 3300046543 Bacteria 5293
161 Ga0495658_0027080 3300046683 Bacteria 3080
162 Ga0495613_0101143 3300046689 Unclassified 2082
163 Ga0495604_0044284 3300047317 Bacteria 3478
164 Ga0495675_0023986 3300047444 Bacteria 3887
165 Ga0495675_0040534 3300047444 Bacteria 2968
166 Ga0495593_0077358 3300047673 Bacteria 1724
167 Ga0496102_0085849 3300048905 Bacteria 2907
168 Ga0496104_0068083 3300048907 Bacteria 3383
169 Ga0496112_0015470 3300048915 Bacteria 7121
170 Ga0496115_0042119 3300048918 Unclassified 3637
171 Ga0501031_0012201 3300049568 Archaea 5601
172 Ga0501047_0081236 3300049581 Bacteria 3116
173 nmdc:mga0rr50_24062_c1 3300050513 Bacteria 4213
174 nmdc:mga08x19_25977_c1 3300050514 Unclassified 3652
175 Ga0495619_0024470 3300053085 Bacteria 3873
176 Ga0500645_000358 3300053730 Bacteria 32498
177 Ga0466962_0024372 3300061719 Bacteria 2907
178 2788433083 2786546940 Bacteria 6396474
179 Ga0070695_100052581
180 Ga0070683_100040042
181 Ga0070683_100049290
182 Ga0070690_100027420
183 Ga0070680_100061481
184 Ga0068868_100001829
185 Ga0068868_100033010
186 Ga0070671_100064632
187 Ga0070673_100061018
188 Ga0070709_10012809
189 Ga0070709_10017070
190 Ga0070714_100000856
191 Ga0070714_100001854
192 Ga0070714_100004177
193 Ga0070713_100007656
194 Ga0070713_100022051
195 Ga0070710_10001253
196 Ga0070710_10053926
197 Ga0070711_100011042
198 Ga0070700_100026146
199 Ga0070681_10001774
200 Ga0070681_10015331
201 Ga0070698_100061026
202 Ga0070679_100022341
203 Ga0068853_100026930
204 Ga0070695_100016986
205 Ga0068855_100000731
206 Ga0068855_100005009
207 Ga0068855_100105234
208 Ga0070664_100000087
209 Ga0068857_100000022
210 Ga0068857_100006309
211 Ga0068856_100000739
212 Ga0068856_100003505
213 Ga0068856_100015872
214 Ga0068864_100000346
215 Ga0068863_100009860
216 Ga0068858_100000464
217 Ga0068860_100000347
218 Ga0081539_10032659
219 Ga0070717_10000012
220 Ga0070717_10002335
221 Ga0070717_10003586
222 Ga0070716_100054869
223 Ga0070712_100014025
224 Ga0070712_100023632
225 Ga0097621_100000373
226 Ga0097621_100001580
227 Ga0068871_100000052
228 Ga0068871_100001454
229 Ga0068865_100004197
230 Ga0068865_100004711
231 Ga0075436_100032645
232 Ga0075435_100024560
233 Ga0105240_10007121
234 Ga0105240_10071377
235 Ga0105240_10104443
236 Ga0105240_10201447
237 Ga0105247_10009107
238 Ga0105242_10041916
239 Ga0105248_10110064
240 Ga0105238_10000289
241 Ga0105249_10103971
242 Ga0157369_10000243
243 Ga0157369_10000300
244 Ga0157369_10128911
245 Ga0157374_10000592
246 Ga0157374_10002897
247 Ga0157374_10020630
248 Ga0157378_10000060
249 Ga0157378_10000401
250 Ga0163162_10012586
251 Ga0157372_10000478
252 Ga0157372_10000515
253 Ga0157372_10000528
254 Ga0157372_10001520
255 Ga0157372_10041513
256 Ga0157372_10123765
257 Ga0163163_10028053
258 Ga0163163_10039610
259 Ga0163163_10058238
260 Ga0228598_1004048
261 Ga0207692_10041591
262 Ga0207699_10014745
263 Ga0207699_10028592
264 Ga0207699_10041985
265 Ga0207684_10058150
266 Ga0207707_10005175
267 Ga0207707_10040550
268 Ga0207695_10061305
269 Ga0207695_10072819
270 Ga0207695_10076492
271 Ga0207695_10149754
272 Ga0207693_10011641
273 Ga0207693_10027314
274 Ga0207693_10029438
275 Ga0207663_10054369
276 Ga0207652_10005076
277 Ga0207694_10008264
278 Ga0207694_10072651
279 Ga0207650_10001063
280 Ga0207700_10005442
281 Ga0207700_10017580
282 Ga0207664_10009850
283 Ga0207686_10037141
284 Ga0207665_10018750
285 Ga0207665_10020916
286 Ga0207661_10053572
287 Ga0207679_10001484
288 Ga0207667_10000252
289 Ga0207667_10000509
290 Ga0207667_10005045
291 Ga0207640_10002391
292 Ga0207677_10001513
293 Ga0207703_10001699
294 Ga0207702_10000120
295 Ga0207702_10000375
296 Ga0207702_10012907
297 Ga0207702_10019841
298 Ga0207641_10012819
299 Ga0207676_10015732
300 Ga0207674_10000056
301 Ga0207674_10004301
302 Ga0207674_10023157
303 Ga0207683_10028266
304 Ga0209974_10004103
305 Ga0268264_10002883
306 Ga0265319_1003979
307 Ga0265319_1019203
308 Ga0265338_10002606
309 Ga0265338_10008987
310 Ga0265338_10021353
311 Ga0265338_10110456
312 Ga0265760_10000691
313 Ga0265320_10002332
314 Ga0265320_10006837
315 Ga0265325_10002267
316 Ga0373926_0013744
317 Ga0373931_0042791
318 Ga0373933_0043241
319 Ga0373947_0006150
320 Ga0373925_0006139
321 Ga0373925_0008774
322 Ga0395905_0000026
323 Ga0395905_0060243
324 Ga0436361_0719406
325 Ga0436362_0045904
326 Ga0451577_0075544
327 Ga0466965_0015074
328 Ga0466963_0004031
329 Ga0466964_0049792
330 Ga0453684_0131385
331 Ga0451576_0072124
332 Ga0495651_0108504
333 Ga0495580_0000228
334 Ga0495580_0029745
335 Ga0495580_0037584
336 Ga0495664_0020615
337 Ga0495665_0000347
338 Ga0495645_0016369
339 Ga0495658_0027080
340 Ga0495613_0101143
341 Ga0495604_0044284
342 Ga0495675_0023986
343 Ga0495675_0040534
344 Ga0495593_0077358
345 Ga0496102_0085849
346 Ga0496104_0068083
347 Ga0496112_0015470
348 Ga0496115_0042119
349 Ga0501031_0012201
350 Ga0501047_0081236
351 nmdc:mga0rr50_24062_c1
352 nmdc:mga08x19_25977_c1
353 Ga0495619_0024470
354 Ga0500645_000358
355 Ga0466962_0024372
356 2788433083

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00654

Voltage_CLC

Voltage gated chloride channel

79

421

0.97

PF00571

CBS

CBS domain

454

515

0.93

PF00571

CBS

CBS domain

527

581

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dqw-assembly1.cif.gz_B crystal structure analysis of pa3770 0.8847 464 581
2p9m-assembly2.cif.gz_C crystal structure of conserved hypothetical protein mj0922 from methanocaldococcus jannaschii dsm 2661 0.8786 453 583
2fec-assembly1.cif.gz_B structure of the e203q mutant of the cl-/h+ exchanger clc-ec1 from e.coli 0.8778 42 440
1ott-assembly1.cif.gz_B structure of the escherichia coli clc chloride channel e148a mutant and fab complex 0.8742 43 440
6k5a-assembly1.cif.gz_B crystal structure of the e148d/r147a/f317a mutant in presence of 200 mm nabr 0.8734 42 440
ID Description Score Start End Superfamily
af_Q58629_165_294_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8994 457 578 3.10.580.10
3kpbA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8955 456 579 3.10.580.10
2yzqA01 Alpha Beta;Roll;CBS-domain;CBS-domain 0.891 456 584 3.10.580.10
1kplD00 Mainly Alpha;Orthogonal Bundle;Clc chloride channel;Clc chloride channel 0.8714 42 440 1.10.3080.10
2yzqA02 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8694 453 579 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A534ZFK2-F1-model_v4 Chloride channel protein 0.9576 39 251 GO:0005247
GO:0016020
AF-A0A3M1FMN7-F1-model_v4 Chloride channel protein 0.9404 41 273 GO:0005247
GO:0016020
AF-A0A7W0SEC2-F1-model_v4 Chloride channel protein 0.9385 95 320 GO:0005247
GO:0016020
AF-A0A6N6VT00-F1-model_v4 Chloride channel protein 0.9333 39 452 GO:0005247
GO:0016020
AF-A0A3M1KZV0-F1-model_v4 Chloride channel protein 0.9299 46 336 GO:0005247
GO:0016020

Map