F271142

General Info

Members Datasets Scaffolds Average Seq Length
178 82 178 190

Family's Representative Sequence

Representative Sequence 2162886012|MBSR1b_contig_9497170|MBSR1b_0734.00003010
Length 214
Sequence MVNGPSSKRNFSPFSLSNPLKEPCVDNEQAFIQRAQKGDQDAFAVLVDEHQRYVYNLALRVLKDENEALDLTQETFVRAWTALPNFRGQSQFRTWLYRIVTNLCYNRLPNLRRSLTDLGDDVISEIPETDLTFDNPARGFESRELRAHLHNAIESLDENYRLLISLRYQNELSYEEMANMLNLPLGTVKTGLYRAKEQLRLALERYQEASWIIP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
50 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
51 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
52 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
60 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
61 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
65 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
68 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
69 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
70 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
71 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
72 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
73 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
74 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
75 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
76 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
77 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
78 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
79 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
80 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
81 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
82 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 0
Rhizosphere 99.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1765348 2162886007 Bacteria 13572
2 MBSR1b_contig_9497170 2162886012 Bacteria 1582
3 Ga0055536_1001408 3300003781 Bacteria 14530
4 Ga0065704_10000466 3300005289 Bacteria 25227
5 Ga0065704_10087377 3300005289 Bacteria 3031
6 Ga0065704_10095989 3300005289 Unclassified 2463
7 Ga0065707_10000841 3300005295 Bacteria 28277
8 Ga0065707_10003288 3300005295 Bacteria 6037
9 Ga0065707_10004036 3300005295 Unclassified 4266
10 Ga0065707_10046147 3300005295 Unclassified 849
11 Ga0065707_10084296 3300005295 Bacteria 7375
12 Ga0065707_10096145 3300005295 Bacteria 3300
13 Ga0065707_10301228 3300005295 Unclassified 1004
14 Ga0070680_100051003 3300005336 Unclassified 3376
15 Ga0070689_100028509 3300005340 Bacteria 4220
16 Ga0070689_100126429 3300005340 Bacteria 2046
17 Ga0070689_101094136 3300005340 Unclassified 712
18 Ga0070669_100375739 3300005353 Bacteria 1158
19 Ga0070701_10196643 3300005438 Bacteria 1189
20 Ga0070705_100139918 3300005440 Unclassified 1591
21 Ga0070705_100332139 3300005440 Bacteria 1102
22 Ga0070700_100084063 3300005441 Bacteria 2062
23 Ga0070694_100241686 3300005444 Bacteria 1362
24 Ga0070706_100197206 3300005467 Bacteria 1881
25 Ga0070706_100568657 3300005467 Bacteria 1054
26 Ga0070707_100298110 3300005468 Bacteria 1566
27 Ga0070698_100098137 3300005471 Bacteria 2904
28 Ga0070698_100192017 3300005471 Bacteria 1979
29 Ga0070698_100228881 3300005471 Bacteria 1792
30 Ga0070698_100464307 3300005471 Bacteria 1202
31 Ga0070699_100011010 3300005518 Bacteria 7821
32 Ga0070699_100031561 3300005518 Bacteria 4574
33 Ga0070699_100139771 3300005518 Unclassified 2138
34 Ga0070697_100281877 3300005536 Unclassified 1426
35 Ga0070704_100198765 3300005549 Bacteria 1617
36 Ga0070704_100715337 3300005549 Bacteria 889
37 Ga0070704_101046951 3300005549 Unclassified 740
38 Ga0068859_100049292 3300005617 Unclassified 4229
39 Ga0068858_100284485 3300005842 Bacteria 1575
40 Ga0068862_100032126 3300005844 Bacteria 4434
41 Ga0068862_100121900 3300005844 Unclassified 2299
42 Ga0068862_100392949 3300005844 Bacteria 1296
43 Ga0081539_10014276 3300005985 Bacteria 5890
44 Ga0075428_100041627 3300006844 Bacteria 5051
45 Ga0075428_100146414 3300006844 Bacteria 2567
46 Ga0075428_100298400 3300006844 Unclassified 1732
47 Ga0075428_100526075 3300006844 Unclassified 1265
48 Ga0075428_101215968 3300006844 Bacteria 794
49 Ga0075430_100159595 3300006846 Unclassified 1877
50 Ga0075430_100618830 3300006846 Unclassified 893
51 Ga0075431_100049989 3300006847 Bacteria 4311
52 Ga0075431_100130543 3300006847 Bacteria 2592
53 Ga0075431_100272753 3300006847 Unclassified 1714
54 Ga0075433_10043332 3300006852 Unclassified 3905
55 Ga0075433_10155469 3300006852 Bacteria 2035
56 Ga0075433_11224653 3300006852 Unclassified 651
57 Ga0075434_100437576 3300006871 Bacteria 1329
58 Ga0075429_100015190 3300006880 Bacteria 6673
59 Ga0075429_100019696 3300006880 Bacteria 5850
60 Ga0075429_100027492 3300006880 Unclassified 4938
61 Ga0075429_100049340 3300006880 Unclassified 3660
62 Ga0075429_100110638 3300006880 Bacteria 2401
63 Ga0075429_100206861 3300006880 Bacteria 1719
64 Ga0097620_100049291 3300006931 Unclassified 4229
65 Ga0111539_10019766 3300009094 Bacteria 8306
66 Ga0114129_10000864 3300009147 Bacteria 39418
67 Ga0114129_10025082 3300009147 Bacteria 8449
68 Ga0114129_10032050 3300009147 Bacteria 7429
69 Ga0114129_10037327 3300009147 Bacteria 6860
70 Ga0114129_10080006 3300009147 Unclassified 4544
71 Ga0114129_10125133 3300009147 Unclassified 3535
72 Ga0114129_10348448 3300009147 Unclassified 1962
73 Ga0105243_11049850 3300009148 Bacteria 820
74 Ga0105241_10135537 3300009174 Bacteria 1999
75 Ga0105249_10020422 3300009553 Bacteria 5922
76 Ga0105249_10470245 3300009553 Bacteria 1298
77 Ga0105239_10890707 3300010375 Bacteria 1021
78 Ga0105246_10034235 3300011119 Bacteria 3383
79 Ga0105246_10116312 3300011119 Bacteria 1974
80 Ga0157380_10565531 3300014326 Bacteria 1118
81 Ga0157380_11615288 3300014326 Bacteria 704
82 Ga0157379_10468036 3300014968 Bacteria 1165
83 Ga0207660_10110903 3300025917 Bacteria 2064
84 Ga0207646_10392329 3300025922 Bacteria 1254
85 Ga0207709_10211022 3300025935 Bacteria 1394
86 Ga0207670_10407956 3300025936 Bacteria 1088
87 Ga0207708_10116422 3300026075 Bacteria 2079
88 Ga0207676_10338671 3300026095 Unclassified 1387
89 Ga0207674_10268583 3300026116 Bacteria 1653
90 Ga0207674_10912167 3300026116 Unclassified 847
91 Ga0207675_100609402 3300026118 Bacteria 1095
92 Ga0268265_10430479 3300028380 Unclassified 1227
93 Ga0268265_10646178 3300028380 Bacteria 1016
94 Ga0268265_10673946 3300028380 Bacteria 996
95 Ga0265338_10020992 3300028800 Bacteria 6832
96 Ga0265339_10091547 3300031249 Bacteria 1593
97 Ga0265316_10255376 3300031344 Bacteria 1286
98 Ga0265314_10102703 3300031711 Unclassified 1834
99 Ga0307413_10061268 3300031824 Bacteria 2321
100 Ga0307410_10251997 3300031852 Bacteria 1373
101 Ga0307406_10653812 3300031901 Bacteria 873
102 Ga0307407_10086909 3300031903 Unclassified 1906
103 Ga0307416_100090904 3300032002 Bacteria 2620
104 Ga0307414_10160940 3300032004 Bacteria 1783
105 Ga0307414_10361865 3300032004 Bacteria 1249
106 Ga0373937_1111587 3300036401 Bacteria 739
107 Ga0439434_0098001 3300042435 Bacteria 943
108 Ga0451577_0096235 3300042876 Bacteria 2643
109 Ga0451577_0100661 3300042876 Bacteria 2581
110 Ga0451577_0215096 3300042876 Unclassified 1737
111 Ga0451577_0736475 3300042876 Unclassified 892
112 Ga0451577_0972698 3300042876 Unclassified 763
113 Ga0451577_1070886 3300042876 Bacteria 722
114 Ga0451577_1120536 3300042876 Unclassified 704
115 Ga0453683_0098382 3300044673 Bacteria 1837
116 Ga0453683_0107285 3300044673 Bacteria 1755
117 Ga0453683_0109785 3300044673 Bacteria 1734
118 Ga0453683_0145459 3300044673 Bacteria 1496
119 Ga0453683_0520245 3300044673 Unclassified 773
120 Ga0453684_0004855 3300044712 Bacteria 27599
121 Ga0453684_0015087 3300044712 Bacteria 12260
122 Ga0453684_0017534 3300044712 Bacteria 11083
123 Ga0453684_0023498 3300044712 Bacteria 9071
124 Ga0453684_0102352 3300044712 Bacteria 3502
125 Ga0453684_0119999 3300044712 Unclassified 3177
126 Ga0453684_0145260 3300044712 Unclassified 2827
127 Ga0453684_0174237 3300044712 Bacteria 2532
128 Ga0453684_0198889 3300044712 Bacteria 2338
129 Ga0453684_0206335 3300044712 Bacteria 2287
130 Ga0453684_0269895 3300044712 Bacteria 1945
131 Ga0453684_0301985 3300044712 Bacteria 1819
132 Ga0453684_0328906 3300044712 Unclassified 1729
133 Ga0453684_0437703 3300044712 Bacteria 1458
134 Ga0453684_0465152 3300044712 Bacteria 1405
135 Ga0453684_0486649 3300044712 Bacteria 1368
136 Ga0453684_0998034 3300044712 Bacteria 890
137 Ga0453684_1239266 3300044712 Unclassified 781
138 Ga0453684_1680421 3300044712 Unclassified 649
139 Ga0451576_0009453 3300045051 Bacteria 11300
140 Ga0451576_0010156 3300045051 Bacteria 10831
141 Ga0451576_0031635 3300045051 Bacteria 5640
142 Ga0451576_0196958 3300045051 Bacteria 2104
143 Ga0451576_0213361 3300045051 Bacteria 2016
144 Ga0451576_0953013 3300045051 Bacteria 900
145 Ga0495630_0320832 3300046517 Bacteria 1184
146 Ga0501032_0665835 3300049569 Unclassified 661
147 Ga0501040_0134830 3300049576 Bacteria 1738
148 Ga0501071_0403816 3300049587 Bacteria 1043
149 Ga0501072_0783256 3300049588 Unclassified 747
150 Ga0501074_0373750 3300049590 Bacteria 1011
151 Ga0501075_0180174 3300049591 Bacteria 1612
152 Ga0501075_0560189 3300049591 Bacteria 872
153 Ga0501076_0021349 3300049592 Unclassified 4966
154 Ga0501079_0468578 3300049741 Unclassified 990
155 Ga0501079_0753770 3300049741 Unclassified 766
156 Ga0501080_0147902 3300049742 Bacteria 2172
157 Ga0501081_0522716 3300049743 Unclassified 885
158 nmdc:mga05p37_127017_c1 3300050507 Bacteria 3131
159 nmdc:mga05p37_1764_c1 3300050507 Bacteria 25269
160 nmdc:mga05p37_189076_c1 3300050507 Unclassified 2501
161 nmdc:mga05p37_318797_c1 3300050507 Unclassified 1840
162 nmdc:mga05p37_44278_c1 3300050507 Bacteria 5476
163 nmdc:mga05p37_65776_c1 3300050507 Bacteria 4460
164 nmdc:mga05p37_85721_c1 3300050507 Bacteria 3882
165 nmdc:mga09592_10661_c1 3300050508 Bacteria 7483
166 nmdc:mga09592_249883_c1 3300050508 Unclassified 1537
167 nmdc:mga09592_41596_c1 3300050508 Unclassified 3864
168 nmdc:mga09592_73790_c1 3300050508 Unclassified 2899
169 nmdc:mga0qj67_585541_c1 3300050509 Unclassified 893
170 nmdc:mga06r32_264091_c1 3300050510 Bacteria 1709
171 nmdc:mga06r32_311790_c1 3300050510 Unclassified 1559
172 nmdc:mga0n895_68738_c1 3300050512 Unclassified 3509
173 nmdc:mga0a205_117317_c2 3300050515 Bacteria 1464
174 nmdc:mga0a205_984064_c1 3300050515 Bacteria 690
175 Ga0501084_1012604 3300054114 Unclassified 698
176 Ga0530510_0036168 3300061734 Bacteria 3559
177 Ga0530510_0401966 3300061734 Unclassified 1033
178 Ga0530510_0448805 3300061734 Unclassified 975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0145459 Ga0453683_0145459_12_545 176
2 3300044712 Ga0453684_0015087 Ga0453684_0015087_8666_9232 176
3 3300031901 Ga0307406_10653812 Ga0307406_106538122 181
4 3300003781 Ga0055536_1001408 Ga0055536_10014086 182
5 3300032004 Ga0307414_10160940 Ga0307414_101609404 182
6 3300026118 Ga0207675_100609402 Ga0207675_1006094021 184
7 3300028800 Ga0265338_10020992 Ga0265338_100209924 184
8 3300031249 Ga0265339_10091547 Ga0265339_100915472 184
9 3300031344 Ga0265316_10255376 Ga0265316_102553762 184
10 3300031711 Ga0265314_10102703 Ga0265314_101027033 184
11 3300005295 Ga0065707_10046147 Ga0065707_100461471 185
12 3300005467 Ga0070706_100197206 Ga0070706_1001972063 185
13 3300005467 Ga0070706_100568657 Ga0070706_1005686571 185
14 3300005468 Ga0070707_100298110 Ga0070707_1002981101 185
15 3300005471 Ga0070698_100192017 Ga0070698_1001920172 185
16 3300005471 Ga0070698_100228881 Ga0070698_1002288812 185
17 3300005518 Ga0070699_100031561 Ga0070699_1000315612 185
18 3300005518 Ga0070699_100139771 Ga0070699_1001397712 185
19 3300005536 Ga0070697_100281877 Ga0070697_1002818772 185
20 3300005549 Ga0070704_101046951 Ga0070704_1010469511 185
21 3300006844 Ga0075428_100298400 Ga0075428_1002984002 185
22 3300006852 Ga0075433_11224653 Ga0075433_112246531 185
23 3300006880 Ga0075429_100206861 Ga0075429_1002068613 185
24 3300009147 Ga0114129_10080006 Ga0114129_100800065 185
25 3300025922 Ga0207646_10392329 Ga0207646_103923291 185
26 3300036401 Ga0373937_1111587 Ga0373937_1111587_90_659 185
27 3300044673 Ga0453683_0520245 Ga0453683_0520245_162_719 185
28 3300046517 Ga0495630_0320832 Ga0495630_0320832_343_906 185
29 3300050507 nmdc:mga05p37_65776_c1 nmdc:mga05p37_65776_c1_662_1219 185
30 3300050507 nmdc:mga05p37_85721_c1 nmdc:mga05p37_85721_c1_374_934 185
31 3300050508 nmdc:mga09592_249883_c1 nmdc:mga09592_249883_c1_501_1058 185
32 3300050515 nmdc:mga0a205_984064_c1 nmdc:mga0a205_984064_c1_108_668 185
33 3300005295 Ga0065707_10084296 Ga0065707_100842967 187
34 3300005295 Ga0065707_10096145 Ga0065707_100961453 187
35 3300005340 Ga0070689_100126429 Ga0070689_1001264293 187
36 3300005844 Ga0068862_100392949 Ga0068862_1003929492 187
37 3300006880 Ga0075429_100015190 Ga0075429_1000151903 187
38 3300009147 Ga0114129_10025082 Ga0114129_100250828 187
39 3300009553 Ga0105249_10470245 Ga0105249_104702452 187
40 3300025936 Ga0207670_10407956 Ga0207670_104079561 187
41 3300028380 Ga0268265_10646178 Ga0268265_106461781 187
42 3300042876 Ga0451577_0096235 Ga0451577_0096235_327_905 187
43 3300042876 Ga0451577_0100661 Ga0451577_0100661_1896_2462 187
44 3300042876 Ga0451577_0215096 Ga0451577_0215096_282_848 187
45 3300042876 Ga0451577_0972698 Ga0451577_0972698_35_622 187
46 3300042876 Ga0451577_1070886 Ga0451577_1070886_28_594 187
47 3300044673 Ga0453683_0098382 Ga0453683_0098382_439_1026 187
48 3300044673 Ga0453683_0107285 Ga0453683_0107285_1085_1651 187
49 3300044712 Ga0453684_0004855 Ga0453684_0004855_10535_11101 187
50 3300044712 Ga0453684_0017534 Ga0453684_0017534_2967_3545 187
51 3300044712 Ga0453684_0023498 Ga0453684_0023498_1991_2557 187
52 3300044712 Ga0453684_0102352 Ga0453684_0102352_376_942 187
53 3300044712 Ga0453684_0119999 Ga0453684_0119999_2414_2980 187
54 3300044712 Ga0453684_0145260 Ga0453684_0145260_1933_2499 187
55 3300044712 Ga0453684_0206335 Ga0453684_0206335_283_849 187
56 3300044712 Ga0453684_0269895 Ga0453684_0269895_736_1302 187
57 3300044712 Ga0453684_0301985 Ga0453684_0301985_393_956 187
58 3300044712 Ga0453684_0328906 Ga0453684_0328906_936_1502 187
59 3300044712 Ga0453684_0465152 Ga0453684_0465152_694_1260 187
60 3300044712 Ga0453684_0998034 Ga0453684_0998034_305_871 187
61 3300044712 Ga0453684_1239266 Ga0453684_1239266_34_597 187
62 3300044712 Ga0453684_1680421 Ga0453684_1680421_59_622 187
63 3300045051 Ga0451576_0009453 Ga0451576_0009453_2951_3529 187
64 3300045051 Ga0451576_0010156 Ga0451576_0010156_8066_8653 187
65 3300045051 Ga0451576_0213361 Ga0451576_0213361_776_1342 187
66 3300045051 Ga0451576_0953013 Ga0451576_0953013_248_811 187
67 3300050507 nmdc:mga05p37_44278_c1 nmdc:mga05p37_44278_c1_1724_2287 187
68 3300050508 nmdc:mga09592_41596_c1 nmdc:mga09592_41596_c1_212_775 187
69 3300006844 Ga0075428_100041627 Ga0075428_1000416272 188
70 3300006847 Ga0075431_100049989 Ga0075431_1000499892 188
71 3300006880 Ga0075429_100027492 Ga0075429_1000274923 188
72 3300009147 Ga0114129_10037327 Ga0114129_100373275 188
73 3300050510 nmdc:mga06r32_264091_c1 nmdc:mga06r32_264091_c1_457_1026 188
74 3300005295 Ga0065707_10301228 Ga0065707_103012281 189
75 3300005518 Ga0070699_100011010 Ga0070699_1000110102 189
76 3300006846 Ga0075430_100159595 Ga0075430_1001595951 189
77 3300006847 Ga0075431_100130543 Ga0075431_1001305434 189
78 3300006880 Ga0075429_100049340 Ga0075429_1000493403 189
79 3300009094 Ga0111539_10019766 Ga0111539_100197665 189
80 3300044673 Ga0453683_0109785 Ga0453683_0109785_69_641 189
81 3300044712 Ga0453684_0174237 Ga0453684_0174237_1598_2170 189
82 3300044712 Ga0453684_0437703 Ga0453684_0437703_510_1082 189
83 3300050510 nmdc:mga06r32_311790_c1 nmdc:mga06r32_311790_c1_679_1248 189
84 3300005289 Ga0065704_10000466 Ga0065704_100004668 190
85 3300005289 Ga0065704_10087377 Ga0065704_100873773 190
86 3300005289 Ga0065704_10095989 Ga0065704_100959893 190
87 3300005295 Ga0065707_10000841 Ga0065707_1000084116 190
88 3300005295 Ga0065707_10003288 Ga0065707_100032882 190
89 3300005295 Ga0065707_10004036 Ga0065707_100040361 190
90 3300005336 Ga0070680_100051003 Ga0070680_1000510031 190
91 3300005340 Ga0070689_100028509 Ga0070689_1000285093 190
92 3300005340 Ga0070689_101094136 Ga0070689_1010941361 190
93 3300005353 Ga0070669_100375739 Ga0070669_1003757392 190
94 3300005438 Ga0070701_10196643 Ga0070701_101966433 190
95 3300005440 Ga0070705_100139918 Ga0070705_1001399183 190
96 3300005440 Ga0070705_100332139 Ga0070705_1003321392 190
97 3300005441 Ga0070700_100084063 Ga0070700_1000840633 190
98 3300005444 Ga0070694_100241686 Ga0070694_1002416862 190
99 3300005471 Ga0070698_100098137 Ga0070698_1000981373 190
100 3300005471 Ga0070698_100464307 Ga0070698_1004643071 190
101 3300005549 Ga0070704_100198765 Ga0070704_1001987653 190
102 3300005549 Ga0070704_100715337 Ga0070704_1007153371 190
103 3300005617 Ga0068859_100049292 Ga0068859_1000492923 190
104 3300005842 Ga0068858_100284485 Ga0068858_1002844853 190
105 3300005844 Ga0068862_100032126 Ga0068862_1000321264 190
106 3300005844 Ga0068862_100121900 Ga0068862_1001219001 190
107 3300005985 Ga0081539_10014276 Ga0081539_100142761 190
108 3300006844 Ga0075428_100146414 Ga0075428_1001464142 190
109 3300006844 Ga0075428_100526075 Ga0075428_1005260752 190
110 3300006844 Ga0075428_101215968 Ga0075428_1012159681 190
111 3300006846 Ga0075430_100618830 Ga0075430_1006188302 190
112 3300006847 Ga0075431_100272753 Ga0075431_1002727532 190
113 3300006852 Ga0075433_10043332 Ga0075433_100433324 190
114 3300006852 Ga0075433_10155469 Ga0075433_101554693 190
115 3300006871 Ga0075434_100437576 Ga0075434_1004375762 190
116 3300006880 Ga0075429_100019696 Ga0075429_1000196964 190
117 3300006880 Ga0075429_100110638 Ga0075429_1001106383 190
118 3300006931 Ga0097620_100049291 Ga0097620_1000492914 190
119 3300009147 Ga0114129_10000864 Ga0114129_1000086439 190
120 3300009147 Ga0114129_10032050 Ga0114129_100320504 190
121 3300009147 Ga0114129_10125133 Ga0114129_101251333 190
122 3300009147 Ga0114129_10348448 Ga0114129_103484483 190
123 3300009148 Ga0105243_11049850 Ga0105243_110498502 190
124 3300009174 Ga0105241_10135537 Ga0105241_101355371 190
125 3300009553 Ga0105249_10020422 Ga0105249_100204225 190
126 3300010375 Ga0105239_10890707 Ga0105239_108907071 190
127 3300011119 Ga0105246_10034235 Ga0105246_100342354 190
128 3300011119 Ga0105246_10116312 Ga0105246_101163123 190
129 3300014326 Ga0157380_10565531 Ga0157380_105655312 190
130 3300014326 Ga0157380_11615288 Ga0157380_116152881 190
131 3300014968 Ga0157379_10468036 Ga0157379_104680362 190
132 3300025917 Ga0207660_10110903 Ga0207660_101109032 190
133 3300025935 Ga0207709_10211022 Ga0207709_102110222 190
134 3300026075 Ga0207708_10116422 Ga0207708_101164223 190
135 3300026095 Ga0207676_10338671 Ga0207676_103386712 190
136 3300026116 Ga0207674_10268583 Ga0207674_102685832 190
137 3300026116 Ga0207674_10912167 Ga0207674_109121671 190
138 3300028380 Ga0268265_10430479 Ga0268265_104304793 190
139 3300028380 Ga0268265_10673946 Ga0268265_106739461 190
140 3300031824 Ga0307413_10061268 Ga0307413_100612682 190
141 3300031852 Ga0307410_10251997 Ga0307410_102519972 190
142 3300031903 Ga0307407_10086909 Ga0307407_100869092 190
143 3300032002 Ga0307416_100090904 Ga0307416_1000909043 190
144 3300032004 Ga0307414_10361865 Ga0307414_103618652 190
145 3300042435 Ga0439434_0098001 Ga0439434_0098001_315_890 190
146 3300042876 Ga0451577_0736475 Ga0451577_0736475_275_847 190
147 3300042876 Ga0451577_1120536 Ga0451577_1120536_112_690 190
148 3300044712 Ga0453684_0198889 Ga0453684_0198889_1425_1997 190
149 3300044712 Ga0453684_0486649 Ga0453684_0486649_236_808 190
150 3300045051 Ga0451576_0031635 Ga0451576_0031635_501_1073 190
151 3300045051 Ga0451576_0196958 Ga0451576_0196958_1018_1590 190
152 3300049569 Ga0501032_0665835 Ga0501032_0665835_36_611 190
153 3300049576 Ga0501040_0134830 Ga0501040_0134830_890_1465 190
154 3300049587 Ga0501071_0403816 Ga0501071_0403816_281_856 190
155 3300049588 Ga0501072_0783256 Ga0501072_0783256_161_736 190
156 3300049590 Ga0501074_0373750 Ga0501074_0373750_135_710 190
157 3300049591 Ga0501075_0180174 Ga0501075_0180174_547_1122 190
158 3300049591 Ga0501075_0560189 Ga0501075_0560189_144_719 190
159 3300049592 Ga0501076_0021349 Ga0501076_0021349_1182_1757 190
160 3300049741 Ga0501079_0468578 Ga0501079_0468578_155_730 190
161 3300049741 Ga0501079_0753770 Ga0501079_0753770_90_665 190
162 3300049742 Ga0501080_0147902 Ga0501080_0147902_940_1515 190
163 3300049743 Ga0501081_0522716 Ga0501081_0522716_188_763 190
164 3300050507 nmdc:mga05p37_127017_c1 nmdc:mga05p37_127017_c1_1051_1623 190
165 3300050507 nmdc:mga05p37_1764_c1 nmdc:mga05p37_1764_c1_9611_10186 190
166 3300050507 nmdc:mga05p37_189076_c1 nmdc:mga05p37_189076_c1_1676_2251 190
167 3300050507 nmdc:mga05p37_318797_c1 nmdc:mga05p37_318797_c1_233_808 190
168 3300050508 nmdc:mga09592_10661_c1 nmdc:mga09592_10661_c1_30_605 190
169 3300050508 nmdc:mga09592_73790_c1 nmdc:mga09592_73790_c1_1241_1816 190
170 3300050509 nmdc:mga0qj67_585541_c1 nmdc:mga0qj67_585541_c1_109_684 190
171 3300050512 nmdc:mga0n895_68738_c1 nmdc:mga0n895_68738_c1_181_753 190
172 3300050515 nmdc:mga0a205_117317_c2 nmdc:mga0a205_117317_c2_465_1037 190
173 3300054114 Ga0501084_1012604 Ga0501084_1012604_26_601 190
174 3300061734 Ga0530510_0036168 Ga0530510_0036168_1257_1832 190
175 3300061734 Ga0530510_0401966 Ga0530510_0401966_208_783 190
176 3300061734 Ga0530510_0448805 Ga0530510_0448805_373_948 190
177 2162886007 SwRhRL2b_contig_1765348 SwRhRL2b_0457.00006950 195
178 2162886012 MBSR1b_contig_9497170 MBSR1b_0734.00003010 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08281

Sigma70_r4_2

Sigma-70, region 4

146

199

0.97

PF04545

Sigma70_r4

Sigma-70, region 4

152

201

0.96

PF04542

Sigma70_r2

Sigma-70 region 2

46

114

0.95

PF12645

HTH_16

Helix-turn-helix domain

29

87

0.82

Feature Viewer

pLDDT pTM Quality
77.33 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map