F270802

General Info

Members Datasets Scaffolds Average Seq Length
177 156 354 129

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0010555|Ga0495668_0010555_1516_1926
Length 136
Sequence LRLLLDTHIALWTLTDDPRLSQAARALILDPANEVCVSAVTLWEIAIKHGLGREGPDRQGMGAMPIGAHDAQVLFSAAGYSLIPITPEQAVIVETLPHIHADPFDRLLVAQGLTDALVLLTHDATVASYNARIIRV

Samples

Sample ID Description Type Environment
1 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
96 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
97 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
98 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
110 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
111 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
118 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
145 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
146 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
147 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
150 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
151 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
154 2855730933 Achromobacter sp. HZ28 Isolate Nodule
155 2855767633 Achromobacter sp. HZ34 Isolate Nodule
156 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.05
Metatranscriptomes 2.26
Isolates 1.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.73
Nodule 1.13
Rhizoplane 1.13
Rhizosphere 81.92
Stem 0
Stem Tuber 0
Unclassified 14.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495668_0010555 3300046616 Bacteria 5582
2 JGI25406J46586_10037504 3300003203 Bacteria 1746
3 Ga0055536_1002035 3300003781 Bacteria 11584
4 Ga0055530_10004804 3300003791 Bacteria 6773
5 Ga0055531_10000646 3300003794 Bacteria 30076
6 Ga0055531_10003045 3300003794 Bacteria 10862
7 Ga0070683_100686621 3300005329 Unclassified 980
8 Ga0068869_101808057 3300005334 Bacteria 546
9 Ga0070680_100011317 3300005336 Bacteria 6900
10 Ga0070660_100007630 3300005339 Bacteria 7539
11 Ga0070661_100385776 3300005344 Unclassified 1105
12 Ga0070659_100140669 3300005366 Unclassified 1965
13 Ga0070659_100518164 3300005366 Bacteria 1018
14 Ga0070701_10044243 3300005438 Bacteria 2281
15 Ga0070663_100085753 3300005455 Bacteria 2324
16 Ga0070681_10053206 3300005458 Bacteria 4034
17 Ga0068867_100367640 3300005459 Unclassified 1205
18 Ga0070679_100044766 3300005530 Bacteria 4409
19 Ga0070684_100924974 3300005535 Unclassified 817
20 Ga0068853_100097070 3300005539 Bacteria 2601
21 Ga0070686_100226762 3300005544 Bacteria 1353
22 Ga0068857_100313690 3300005577 Unclassified 1447
23 Ga0068854_100124252 3300005578 Bacteria 1963
24 Ga0068856_100149627 3300005614 Bacteria 2343
25 Ga0068859_100434678 3300005617 Bacteria 1409
26 Ga0068861_100055480 3300005719 Bacteria 3021
27 Ga0068858_100040312 3300005842 Bacteria 4330
28 Ga0068860_100092724 3300005843 Bacteria 2878
29 Ga0081455_10035773 3300005937 Bacteria 4432
30 Ga0081455_10482176 3300005937 Bacteria 838
31 Ga0081539_10000582 3300005985 Bacteria 75018
32 Ga0075370_10594319 3300006353 Bacteria 670
33 Ga0075428_100088574 3300006844 Bacteria 3376
34 Ga0075430_100003976 3300006846 Bacteria 12465
35 Ga0075430_101025388 3300006846 Unclassified 680
36 Ga0075431_100007062 3300006847 Bacteria 11154
37 Ga0075429_100033194 3300006880 Bacteria 4484
38 Ga0068865_101402729 3300006881 Bacteria 624
39 Ga0097620_100434686 3300006931 Bacteria 1409
40 Ga0099795_10161530 3300007788 Bacteria 925
41 Ga0105240_10216358 3300009093 Bacteria 2235
42 Ga0114129_10380527 3300009147 Bacteria 1864
43 Ga0105243_10142100 3300009148 Bacteria 2049
44 Ga0105237_10207443 3300009545 Bacteria 1960
45 Ga0105238_10103436 3300009551 Bacteria 2829
46 Ga0105249_10564652 3300009553 Bacteria 1190
47 Ga0105239_10651331 3300010375 Bacteria 1203
48 Ga0157370_10071308 3300013104 Bacteria 3278
49 Ga0157369_10271902 3300013105 Bacteria 1765
50 Ga0157378_11534653 3300013297 Unclassified 711
51 Ga0163162_10385461 3300013306 Bacteria 1535
52 Ga0163162_11234930 3300013306 Unclassified 848
53 Ga0157372_10406843 3300013307 Unclassified 1586
54 Ga0157372_10536451 3300013307 Bacteria 1364
55 Ga0157375_10866603 3300013308 Bacteria 1049
56 Ga0163163_10813702 3300014325 Bacteria 998
57 Ga0163163_10960096 3300014325 Unclassified 918
58 Ga0157380_10394798 3300014326 Bacteria 1310
59 Ga0206352_10237434 3300020078 Bacteria 523
60 Ga0206353_11453711 3300020082 Bacteria 991
61 Ga0154015_1480373 3300020610 Unclassified 1784
62 Ga0213872_10040264 3300021361 Bacteria 2134
63 Ga0224712_10127840 3300022467 Bacteria 1107
64 Ga0209676_1000043 3300025292 Bacteria 418680
65 Ga0209564_1028454 3300025295 Bacteria 1786
66 Ga0209050_1001103 3300025298 Bacteria 32702
67 Ga0209257_1000134 3300025304 Bacteria 207628
68 Ga0207705_10008901 3300025909 Bacteria 7315
69 Ga0207707_10004492 3300025912 Bacteria 12278
70 Ga0207695_10041213 3300025913 Bacteria 4943
71 Ga0207671_10551959 3300025914 Bacteria 918
72 Ga0207660_10217778 3300025917 Unclassified 1497
73 Ga0207657_10009142 3300025919 Bacteria 9999
74 Ga0207649_10639227 3300025920 Unclassified 821
75 Ga0207652_10018677 3300025921 Bacteria 5689
76 Ga0207694_10698048 3300025924 Bacteria 856
77 Ga0207690_10129504 3300025932 Bacteria 1845
78 Ga0207686_11121311 3300025934 Bacteria 642
79 Ga0207704_11170584 3300025938 Bacteria 655
80 Ga0207704_11504002 3300025938 Unclassified 578
81 Ga0207661_10724663 3300025944 Unclassified 915
82 Ga0207667_10029319 3300025949 Bacteria 5969
83 Ga0207667_10114744 3300025949 Bacteria 2776
84 Ga0207712_10134744 3300025961 Bacteria 1887
85 Ga0207640_10004962 3300025981 Bacteria 7235
86 Ga0207703_10028523 3300026035 Bacteria 4401
87 Ga0207639_10063340 3300026041 Bacteria 2863
88 Ga0207678_10123086 3300026067 Bacteria 2213
89 Ga0207702_11370876 3300026078 Bacteria 701
90 Ga0207674_10240377 3300026116 Bacteria 1758
91 Ga0207675_100527055 3300026118 Bacteria 1178
92 Ga0207698_10069644 3300026142 Bacteria 2783
93 Ga0209179_1048700 3300027512 Bacteria 905
94 Ga0307515_10059789 3300028794 Bacteria 5453
95 Ga0265327_10000478 3300031251 Bacteria 70530
96 Ga0265327_10013669 3300031251 Bacteria 5375
97 Ga0316579_10209456 3300031691 Bacteria 943
98 Ga0316579_10215040 3300031691 Unclassified 929
99 Ga0307410_11209030 3300031852 Bacteria 658
100 Ga0307409_100284629 3300031995 Bacteria 1530
101 Ga0307409_101228643 3300031995 Bacteria 773
102 Ga0307416_101670732 3300032002 Bacteria 742
103 Ga0307411_10057196 3300032005 Bacteria 2575
104 Ga0373950_0000016 3300034818 Bacteria 277879
105 Ga0373925_0573126 3300037068 Bacteria 929
106 Ga0436361_1027371 3300039447 Bacteria 3528
107 Ga0436363_0017951 3300039450 Bacteria 1235
108 Ga0451855_1178589 3300041511 Unclassified 634
109 Ga0439445_0020925 3300042004 Bacteria 1641
110 Ga0439435_0004555 3300042436 Bacteria 2998
111 Ga0451577_0004409 3300042876 Bacteria 14881
112 Ga0453683_0709805 3300044673 Unclassified 659
113 Ga0453684_0579569 3300044712 Unclassified 1232
114 Ga0466968_0240858 3300044735 Unclassified 857
115 Ga0466957_0937263 3300044842 Bacteria 620
116 Ga0451576_1301234 3300045051 Bacteria 758
117 Ga0451576_1304048 3300045051 Unclassified 757
118 Ga0466958_0876414 3300045836 Bacteria 586
119 Ga0466958_1004420 3300045836 Bacteria 544
120 Ga0466967_0668875 3300045976 Bacteria 1028
121 Ga0495650_0000217 3300046471 Bacteria 120688
122 Ga0495610_0016700 3300046512 Bacteria 4215
123 Ga0495620_0066327 3300046515 Bacteria 1487
124 Ga0495632_0196863 3300046519 Bacteria 919
125 Ga0495663_0154226 3300046525 Bacteria 785
126 Ga0495654_0000042 3300046530 Bacteria 164346
127 Ga0495633_0503587 3300046558 Bacteria 546
128 Ga0495668_0000587 3300046616 Bacteria 44244
129 Ga0495625_0041223 3300046660 Bacteria 3361
130 Ga0495660_0218006 3300046810 Bacteria 901
131 Ga0495672_0005693 3300047320 Bacteria 9820
132 Ga0495679_113372 3300047446 Unclassified 745
133 Ga0495681_0052016 3300047470 Bacteria 1924
134 Ga0495686_0032885 3300047472 Bacteria 3353
135 Ga0496103_0439462 3300048906 Bacteria 837
136 Ga0496112_0242696 3300048915 Bacteria 1754
137 Ga0496121_0075962 3300048924 Bacteria 2681
138 Ga0496124_0004760 3300048927 Bacteria 15628
139 Ga0496125_0032086 3300048928 Bacteria 4670
140 Ga0496125_0087829 3300048928 Bacteria 2346
141 Ga0496126_0009898 3300048929 Bacteria 10074
142 Ga0495678_008327 3300049459 Bacteria 5244
143 Ga0501031_0976198 3300049568 Bacteria 542
144 Ga0501033_0210632 3300049570 Unclassified 1386
145 Ga0501036_0567065 3300049572 Bacteria 943
146 Ga0501038_0210565 3300049574 Bacteria 1555
147 Ga0501040_0228239 3300049576 Bacteria 1325
148 Ga0501047_0009748 3300049581 Bacteria 9079
149 Ga0501067_0000527 3300049583 Bacteria 20935
150 Ga0501067_0249584 3300049583 Bacteria 988
151 Ga0501067_0711566 3300049583 Unclassified 565
152 Ga0501073_0000733 3300049589 Bacteria 23214
153 Ga0501075_0856903 3300049591 Bacteria 691
154 Ga0501076_0778270 3300049592 Bacteria 790
155 Ga0501035_0153842 3300049822 Bacteria 1994
156 Ga0501044_0000065 3300049823 Bacteria 130072
157 nmdc:mga07m45_498795_c1 3300050496 Bacteria 705
158 nmdc:mga05p37_746179_c1 3300050507 Bacteria 1080
159 nmdc:mga09592_83143_c1 3300050508 Bacteria 2729
160 nmdc:mga0qj67_113654_c1 3300050509 Bacteria 2187
161 nmdc:mga0qj67_465735_c1 3300050509 Bacteria 1017
162 nmdc:mga06r32_9070_c1 3300050510 Bacteria 8966
163 Ga0500578_0000692 3300053086 Bacteria 40321
164 Ga0500555_133979 3300053103 Bacteria 613
165 Ga0500594_0001018 3300053118 Bacteria 6001
166 Ga0500559_0002513 3300053136 Bacteria 9424
167 Ga0500616_0009393 3300053153 Bacteria 5953
168 Ga0500622_0072041 3300053156 Bacteria 1745
169 Ga0500622_0088210 3300053156 Bacteria 1543
170 Ga0500627_0015259 3300053158 Bacteria 2964
171 Ga0500645_068618 3300053730 Bacteria 1019
172 Ga0501082_0141040 3300060353 Bacteria 2092
173 Ga0501082_1462406 3300060353 Unclassified 597
174 Ga0530510_0235571 3300061734 Bacteria 1362
175 2855731386 2855730933 Bacteria 7047938
176 2855768092 2855767633 Bacteria 7049357
177 2881413750 2881412998 Bacteria 6492157
178 Ga0495668_0010555
179 JGI25406J46586_10037504
180 Ga0055536_1002035
181 Ga0055530_10004804
182 Ga0055531_10000646
183 Ga0055531_10003045
184 Ga0070683_100686621
185 Ga0068869_101808057
186 Ga0070680_100011317
187 Ga0070660_100007630
188 Ga0070661_100385776
189 Ga0070659_100140669
190 Ga0070659_100518164
191 Ga0070701_10044243
192 Ga0070663_100085753
193 Ga0070681_10053206
194 Ga0068867_100367640
195 Ga0070679_100044766
196 Ga0070684_100924974
197 Ga0068853_100097070
198 Ga0070686_100226762
199 Ga0068857_100313690
200 Ga0068854_100124252
201 Ga0068856_100149627
202 Ga0068859_100434678
203 Ga0068861_100055480
204 Ga0068858_100040312
205 Ga0068860_100092724
206 Ga0081455_10035773
207 Ga0081455_10482176
208 Ga0081539_10000582
209 Ga0075370_10594319
210 Ga0075428_100088574
211 Ga0075430_100003976
212 Ga0075430_101025388
213 Ga0075431_100007062
214 Ga0075429_100033194
215 Ga0068865_101402729
216 Ga0097620_100434686
217 Ga0099795_10161530
218 Ga0105240_10216358
219 Ga0114129_10380527
220 Ga0105243_10142100
221 Ga0105237_10207443
222 Ga0105238_10103436
223 Ga0105249_10564652
224 Ga0105239_10651331
225 Ga0157370_10071308
226 Ga0157369_10271902
227 Ga0157378_11534653
228 Ga0163162_10385461
229 Ga0163162_11234930
230 Ga0157372_10406843
231 Ga0157372_10536451
232 Ga0157375_10866603
233 Ga0163163_10813702
234 Ga0163163_10960096
235 Ga0157380_10394798
236 Ga0206352_10237434
237 Ga0206353_11453711
238 Ga0154015_1480373
239 Ga0213872_10040264
240 Ga0224712_10127840
241 Ga0209676_1000043
242 Ga0209564_1028454
243 Ga0209050_1001103
244 Ga0209257_1000134
245 Ga0207705_10008901
246 Ga0207707_10004492
247 Ga0207695_10041213
248 Ga0207671_10551959
249 Ga0207660_10217778
250 Ga0207657_10009142
251 Ga0207649_10639227
252 Ga0207652_10018677
253 Ga0207694_10698048
254 Ga0207690_10129504
255 Ga0207686_11121311
256 Ga0207704_11170584
257 Ga0207704_11504002
258 Ga0207661_10724663
259 Ga0207667_10029319
260 Ga0207667_10114744
261 Ga0207712_10134744
262 Ga0207640_10004962
263 Ga0207703_10028523
264 Ga0207639_10063340
265 Ga0207678_10123086
266 Ga0207702_11370876
267 Ga0207674_10240377
268 Ga0207675_100527055
269 Ga0207698_10069644
270 Ga0209179_1048700
271 Ga0307515_10059789
272 Ga0265327_10000478
273 Ga0265327_10013669
274 Ga0316579_10209456
275 Ga0316579_10215040
276 Ga0307410_11209030
277 Ga0307409_100284629
278 Ga0307409_101228643
279 Ga0307416_101670732
280 Ga0307411_10057196
281 Ga0373950_0000016
282 Ga0373925_0573126
283 Ga0436361_1027371
284 Ga0436363_0017951
285 Ga0451855_1178589
286 Ga0439445_0020925
287 Ga0439435_0004555
288 Ga0451577_0004409
289 Ga0453683_0709805
290 Ga0453684_0579569
291 Ga0466968_0240858
292 Ga0466957_0937263
293 Ga0451576_1301234
294 Ga0451576_1304048
295 Ga0466958_0876414
296 Ga0466958_1004420
297 Ga0466967_0668875
298 Ga0495650_0000217
299 Ga0495610_0016700
300 Ga0495620_0066327
301 Ga0495632_0196863
302 Ga0495663_0154226
303 Ga0495654_0000042
304 Ga0495633_0503587
305 Ga0495668_0000587
306 Ga0495625_0041223
307 Ga0495660_0218006
308 Ga0495672_0005693
309 Ga0495679_113372
310 Ga0495681_0052016
311 Ga0495686_0032885
312 Ga0496103_0439462
313 Ga0496112_0242696
314 Ga0496121_0075962
315 Ga0496124_0004760
316 Ga0496125_0032086
317 Ga0496125_0087829
318 Ga0496126_0009898
319 Ga0495678_008327
320 Ga0501031_0976198
321 Ga0501033_0210632
322 Ga0501036_0567065
323 Ga0501038_0210565
324 Ga0501040_0228239
325 Ga0501047_0009748
326 Ga0501067_0000527
327 Ga0501067_0249584
328 Ga0501067_0711566
329 Ga0501073_0000733
330 Ga0501075_0856903
331 Ga0501076_0778270
332 Ga0501035_0153842
333 Ga0501044_0000065
334 nmdc:mga07m45_498795_c1
335 nmdc:mga05p37_746179_c1
336 nmdc:mga09592_83143_c1
337 nmdc:mga0qj67_113654_c1
338 nmdc:mga0qj67_465735_c1
339 nmdc:mga06r32_9070_c1
340 Ga0500578_0000692
341 Ga0500555_133979
342 Ga0500594_0001018
343 Ga0500559_0002513
344 Ga0500616_0009393
345 Ga0500622_0072041
346 Ga0500622_0088210
347 Ga0500627_0015259
348 Ga0500645_068618
349 Ga0501082_0141040
350 Ga0501082_1462406
351 Ga0530510_0235571
352 2855731386
353 2855768092
354 2881413750

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

3

132

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ecy-assembly1.cif.gz_H structure of the shigella flexneri vapc mutant d98n crystal form 2 0.7864 2 122
5ed0-assembly2.cif.gz_B structure of the shigella flexneri vapc mutant d7n 0.7762 2 123
5ecy-assembly1.cif.gz_H structure of the shigella flexneri vapc mutant d98n crystal form 2 0.7634 2 122
3tnd-assembly1.cif.gz_G crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.7604 2 124
5ed0-assembly2.cif.gz_B structure of the shigella flexneri vapc mutant d7n 0.7593 2 123
ID Description Score Start End Superfamily
af_P71623_4_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.826 3 116 3.40.50.1010
af_P71623_4_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.765 3 116 3.40.50.1010
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.725 2 122 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.721 2 124 3.40.50.1010
af_O07783_4_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7191 2 123 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A1Q6A3C2-F1-model_v4 PIN domain-containing protein 0.9809 72 124
AF-A0A838FK38-F1-model_v4 PIN domain-containing protein 0.9692 74 124
AF-A0A838FK38-F1-model_v4 PIN domain-containing protein 0.9513 74 124
AF-A0A1Q6A3C2-F1-model_v4 PIN domain-containing protein 0.946 72 124
AF-A0A522TDR9-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9325 2 124

Map