F270577

General Info

Members Datasets Scaffolds Average Seq Length
177 94 354 205

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0018687|Ga0395899_0018687_489_1190
Length 233
Sequence LTPPGRLCCNPCSSVEHDDRLSGAVNGQHLDRDLRLLSAIEEGTPLTQRALAERLGVALGLANLCLKRLARKGYIKVVHFNERPAARKRLRYLLTPKGLAEKSRLTYEHMVYSLQLYRRTRQTLRESLGRLPAAGLERVAFYGSGEAAELAYLTLRELGLEPVAVFGPEPGGRFLGFPVRPLAELAPGQYDAVVVATFDRPDATIETLVGHGVPRAKCVTLRAVAPATNGQRR

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
50 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
51 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
52 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
54 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
55 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
56 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
57 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
58 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
62 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
63 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
64 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
74 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
75 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
76 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
77 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
78 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
79 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
80 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
81 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
83 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
84 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
85 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
86 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
87 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
88 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
89 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
90 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
91 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
92 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
93 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
94 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.56
Rhizosphere 99.44
Stem 0
Stem Tuber 0
Unclassified 9.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0018687 3300037312 Bacteria 5268
2 JGI25406J46586_10012912 3300003203 Bacteria 3606
3 Ga0065707_10002306 3300005295 Bacteria 6074
4 Ga0065707_10127527 3300005295 Bacteria 1982
5 Ga0070676_10707468 3300005328 Bacteria 736
6 Ga0070690_100546153 3300005330 Bacteria 873
7 Ga0070680_100453062 3300005336 Bacteria 1096
8 Ga0070680_100641632 3300005336 Unclassified 912
9 Ga0070682_100038807 3300005337 Bacteria 2923
10 Ga0070692_10111539 3300005345 Unclassified 1513
11 Ga0070674_100011409 3300005356 Bacteria 5412
12 Ga0070673_100113816 3300005364 Bacteria 2247
13 Ga0070694_100058401 3300005444 Bacteria 2625
14 Ga0070694_100091543 3300005444 Bacteria 2135
15 Ga0070708_100057354 3300005445 Bacteria 3467
16 Ga0070708_100789367 3300005445 Bacteria 893
17 Ga0070663_100456479 3300005455 Bacteria 1054
18 Ga0070681_10433244 3300005458 Bacteria 1227
19 Ga0068867_100591078 3300005459 Bacteria 967
20 Ga0068867_100648271 3300005459 Bacteria 926
21 Ga0070707_100369386 3300005468 Unclassified 1394
22 Ga0070679_100494527 3300005530 Bacteria 1167
23 Ga0070695_100020708 3300005545 Bacteria 4017
24 Ga0070695_100060859 3300005545 Bacteria 2447
25 Ga0070696_100099242 3300005546 Bacteria 2084
26 Ga0070696_100569631 3300005546 Bacteria 910
27 Ga0070693_100228479 3300005547 Bacteria 1223
28 Ga0070704_100062749 3300005549 Bacteria 2665
29 Ga0070704_100074946 3300005549 Bacteria 2470
30 Ga0070664_100459269 3300005564 Unclassified 1170
31 Ga0068859_100375528 3300005617 Bacteria 1517
32 Ga0068866_10335175 3300005718 Bacteria 956
33 Ga0081455_10158111 3300005937 Bacteria 1740
34 Ga0081539_10000141 3300005985 Bacteria 166050
35 Ga0075428_100015290 3300006844 Bacteria 8512
36 Ga0075431_100169884 3300006847 Bacteria 2241
37 Ga0075431_100243877 3300006847 Bacteria 1827
38 Ga0075431_100402548 3300006847 Bacteria 1369
39 Ga0075431_100716938 3300006847 Unclassified 977
40 Ga0075433_10033914 3300006852 Bacteria 4380
41 Ga0075433_10203960 3300006852 Bacteria 1758
42 Ga0075433_10355872 3300006852 Bacteria 1293
43 Ga0075433_10654099 3300006852 Bacteria 921
44 Ga0075434_100019583 3300006871 Bacteria 6552
45 Ga0075434_100099243 3300006871 Bacteria 2917
46 Ga0075434_100161895 3300006871 Bacteria 2257
47 Ga0075434_100260249 3300006871 Bacteria 1754
48 Ga0075434_101338213 3300006871 Unclassified 727
49 Ga0075429_100038621 3300006880 Bacteria 4156
50 Ga0068865_100471571 3300006881 Bacteria 1041
51 Ga0075436_100000705 3300006914 Bacteria 22105
52 Ga0097620_100375513 3300006931 Bacteria 1517
53 Ga0075435_100100212 3300007076 Bacteria 2400
54 Ga0075435_100111349 3300007076 Bacteria 2277
55 Ga0075435_100543478 3300007076 Bacteria 1006
56 Ga0111539_10008039 3300009094 Bacteria 13454
57 Ga0111539_10073758 3300009094 Bacteria 4023
58 Ga0111539_10571232 3300009094 Bacteria 1317
59 Ga0114129_10041319 3300009147 Bacteria 6499
60 Ga0114129_10098094 3300009147 Unclassified 4056
61 Ga0114129_10183847 3300009147 Bacteria 2843
62 Ga0114129_10847692 3300009147 Bacteria 1162
63 Ga0114129_10945243 3300009147 Bacteria 1089
64 Ga0157370_10195765 3300013104 Bacteria 1876
65 Ga0157370_10388227 3300013104 Bacteria 1285
66 Ga0157369_10620287 3300013105 Bacteria 1116
67 Ga0157378_10066101 3300013297 Bacteria 3238
68 Ga0207707_10142307 3300025912 Bacteria 2097
69 Ga0207646_10091232 3300025922 Bacteria 2727
70 Ga0207651_10155868 3300025960 Bacteria 1784
71 Ga0207678_10570625 3300026067 Bacteria 991
72 Ga0207648_10054116 3300026089 Bacteria 3506
73 Ga0207648_10747387 3300026089 Bacteria 908
74 Ga0207675_100317635 3300026118 Bacteria 1520
75 Ga0209971_1029321 3300027682 Unclassified 1317
76 Ga0268265_10449201 3300028380 Bacteria 1204
77 Ga0373926_0090321 3300035083 Bacteria 1138
78 Ga0373931_0002800 3300035691 Bacteria 7764
79 Ga0373935_0252109 3300035692 Bacteria 1235
80 Ga0373937_0380297 3300036401 Unclassified 1339
81 Ga0395900_0003137 3300037418 Bacteria 17929
82 Ga0395901_0000854 3300038443 Bacteria 33520
83 Ga0451577_0003981 3300042876 Bacteria 15927
84 Ga0451577_0005721 3300042876 Bacteria 12614
85 Ga0451577_0144326 3300042876 Bacteria 2140
86 Ga0451577_0249862 3300042876 Bacteria 1605
87 Ga0451577_0260317 3300042876 Bacteria 1571
88 Ga0451577_0608793 3300042876 Bacteria 991
89 Ga0453683_0000034 3300044673 Bacteria 235218
90 Ga0453683_0001123 3300044673 Bacteria 24457
91 Ga0453683_0052127 3300044673 Bacteria 2562
92 Ga0453683_0100840 3300044673 Bacteria 1812
93 Ga0466963_0531856 3300044694 Bacteria 830
94 Ga0453684_0000210 3300044712 Bacteria 255463
95 Ga0453684_0000854 3300044712 Bacteria 102660
96 Ga0453684_0020929 3300044712 Bacteria 9815
97 Ga0453684_0023343 3300044712 Bacteria 9119
98 Ga0453684_0053049 3300044712 Bacteria 5296
99 Ga0453684_0960640 3300044712 Bacteria 911
100 Ga0453684_1549331 3300044712 Bacteria 682
101 Ga0451576_0000447 3300045051 Bacteria 93789
102 Ga0451576_0047550 3300045051 Unclassified 4510
103 Ga0451576_0138209 3300045051 Bacteria 2541
104 Ga0451576_0152320 3300045051 Bacteria 2411
105 Ga0451576_0398853 3300045051 Bacteria 1442
106 Ga0466967_1348337 3300045976 Bacteria 710
107 Ga0495594_0032542 3300046499 Bacteria 2831
108 Ga0495581_0226764 3300047315 Bacteria 1093
109 Ga0496106_0543439 3300048909 Bacteria 932
110 Ga0501031_0031931 3300049568 Bacteria 3434
111 Ga0501033_0069381 3300049570 Bacteria 2591
112 Ga0501036_0174557 3300049572 Bacteria 1810
113 Ga0501038_0026262 3300049574 Bacteria 5188
114 Ga0501039_0005195 3300049575 Bacteria 9853
115 Ga0501039_0025702 3300049575 Bacteria 4526
116 Ga0501040_0221985 3300049576 Bacteria 1345
117 Ga0501040_0248747 3300049576 Bacteria 1268
118 Ga0501041_0010775 3300049577 Bacteria 5395
119 Ga0501042_0013063 3300049578 Bacteria 5646
120 Ga0501042_0177511 3300049578 Bacteria 1536
121 Ga0501048_0055827 3300049582 Bacteria 2803
122 Ga0501048_0225699 3300049582 Bacteria 1329
123 Ga0501068_0491825 3300049584 Bacteria 795
124 Ga0501071_0180422 3300049587 Unclassified 1582
125 Ga0501072_0048578 3300049588 Bacteria 3342
126 Ga0501072_0140164 3300049588 Bacteria 1928
127 Ga0501075_0012048 3300049591 Bacteria 6139
128 Ga0501075_0053490 3300049591 Bacteria 3037
129 Ga0501075_0226943 3300049591 Unclassified 1424
130 Ga0501076_0022297 3300049592 Bacteria 4867
131 Ga0501076_0028713 3300049592 Bacteria 4322
132 Ga0501076_0048114 3300049592 Bacteria 3371
133 Ga0501077_0002594 3300049593 Bacteria 10826
134 Ga0501079_0142887 3300049741 Bacteria 1864
135 Ga0501079_0318856 3300049741 Bacteria 1217
136 Ga0501081_0215121 3300049743 Unclassified 1397
137 Ga0501081_0222580 3300049743 Bacteria 1372
138 Ga0501035_0150485 3300049822 Bacteria 2020
139 Ga0501045_0002972 3300049824 Bacteria 11595
140 nmdc:mga05p37_1214214_c1 3300050507 Unclassified 778
141 nmdc:mga05p37_125064_c1 3300050507 Bacteria 3158
142 nmdc:mga05p37_1702_c1 3300050507 Bacteria 25617
143 nmdc:mga05p37_227103_c1 3300050507 Bacteria 2251
144 nmdc:mga05p37_671274_c1 3300050507 Bacteria 1157
145 nmdc:mga05p37_784409_c1 3300050507 Bacteria 1045
146 nmdc:mga05p37_78562_c1 3300050507 Bacteria 4064
147 nmdc:mga09592_56857_c1 3300050508 Bacteria 3306
148 nmdc:mga06r32_393136_c1 3300050510 Bacteria 1369
149 nmdc:mga06r32_480723_c1 3300050510 Bacteria 1220
150 nmdc:mga06r32_68339_c1 3300050510 Bacteria 3432
151 nmdc:mga08y16_1050122_c1 3300050511 Bacteria 792
152 nmdc:mga08y16_170854_c1 3300050511 Bacteria 2258
153 nmdc:mga0n895_103041_c1 3300050512 Bacteria 2865
154 nmdc:mga0n895_17201_c1 3300050512 Bacteria 6663
155 nmdc:mga0n895_18815_c1 3300050512 Bacteria 6402
156 nmdc:mga0n895_293648_c1 3300050512 Bacteria 1648
157 nmdc:mga0n895_372079_c1 3300050512 Bacteria 1446
158 nmdc:mga0rr50_244461_c1 3300050513 Bacteria 1488
159 nmdc:mga0rr50_526574_c1 3300050513 Bacteria 1006
160 nmdc:mga0rr50_56166_c1 3300050513 Bacteria 2941
161 nmdc:mga0rr50_67927_c1 3300050513 Bacteria 2709
162 nmdc:mga08x19_14545_c1 3300050514 Bacteria 4774
163 nmdc:mga08x19_490397_c1 3300050514 Unclassified 867
164 nmdc:mga0a205_150636_c1 3300050515 Bacteria 2226
165 nmdc:mga0a205_247164_c1 3300050515 Bacteria 1664
166 nmdc:mga0a205_281915_c1 3300050515 Unclassified 1537
167 nmdc:mga0a205_35064_c1 3300050515 Bacteria 4817
168 nmdc:mga0a205_71873_c1 3300050515 Bacteria 3342
169 nmdc:mga0a205_779781_c1 3300050515 Bacteria 804
170 Ga0495619_0466395 3300053085 Unclassified 870
171 Ga0501084_0013433 3300054114 Bacteria 6776
172 Ga0501084_0027142 3300054114 Bacteria 4785
173 Ga0501084_0082849 3300054114 Bacteria 2692
174 Ga0501082_0015500 3300060353 Bacteria 6561
175 Ga0501082_0082007 3300060353 Bacteria 2783
176 Ga0501082_0088331 3300060353 Bacteria 2675
177 Ga0530510_0060700 3300061734 Bacteria 2736
178 Ga0395899_0018687
179 JGI25406J46586_10012912
180 Ga0065707_10002306
181 Ga0065707_10127527
182 Ga0070676_10707468
183 Ga0070690_100546153
184 Ga0070680_100453062
185 Ga0070680_100641632
186 Ga0070682_100038807
187 Ga0070692_10111539
188 Ga0070674_100011409
189 Ga0070673_100113816
190 Ga0070694_100058401
191 Ga0070694_100091543
192 Ga0070708_100057354
193 Ga0070708_100789367
194 Ga0070663_100456479
195 Ga0070681_10433244
196 Ga0068867_100591078
197 Ga0068867_100648271
198 Ga0070707_100369386
199 Ga0070679_100494527
200 Ga0070695_100020708
201 Ga0070695_100060859
202 Ga0070696_100099242
203 Ga0070696_100569631
204 Ga0070693_100228479
205 Ga0070704_100062749
206 Ga0070704_100074946
207 Ga0070664_100459269
208 Ga0068859_100375528
209 Ga0068866_10335175
210 Ga0081455_10158111
211 Ga0081539_10000141
212 Ga0075428_100015290
213 Ga0075431_100169884
214 Ga0075431_100243877
215 Ga0075431_100402548
216 Ga0075431_100716938
217 Ga0075433_10033914
218 Ga0075433_10203960
219 Ga0075433_10355872
220 Ga0075433_10654099
221 Ga0075434_100019583
222 Ga0075434_100099243
223 Ga0075434_100161895
224 Ga0075434_100260249
225 Ga0075434_101338213
226 Ga0075429_100038621
227 Ga0068865_100471571
228 Ga0075436_100000705
229 Ga0097620_100375513
230 Ga0075435_100100212
231 Ga0075435_100111349
232 Ga0075435_100543478
233 Ga0111539_10008039
234 Ga0111539_10073758
235 Ga0111539_10571232
236 Ga0114129_10041319
237 Ga0114129_10098094
238 Ga0114129_10183847
239 Ga0114129_10847692
240 Ga0114129_10945243
241 Ga0157370_10195765
242 Ga0157370_10388227
243 Ga0157369_10620287
244 Ga0157378_10066101
245 Ga0207707_10142307
246 Ga0207646_10091232
247 Ga0207651_10155868
248 Ga0207678_10570625
249 Ga0207648_10054116
250 Ga0207648_10747387
251 Ga0207675_100317635
252 Ga0209971_1029321
253 Ga0268265_10449201
254 Ga0373926_0090321
255 Ga0373931_0002800
256 Ga0373935_0252109
257 Ga0373937_0380297
258 Ga0395900_0003137
259 Ga0395901_0000854
260 Ga0451577_0003981
261 Ga0451577_0005721
262 Ga0451577_0144326
263 Ga0451577_0249862
264 Ga0451577_0260317
265 Ga0451577_0608793
266 Ga0453683_0000034
267 Ga0453683_0001123
268 Ga0453683_0052127
269 Ga0453683_0100840
270 Ga0466963_0531856
271 Ga0453684_0000210
272 Ga0453684_0000854
273 Ga0453684_0020929
274 Ga0453684_0023343
275 Ga0453684_0053049
276 Ga0453684_0960640
277 Ga0453684_1549331
278 Ga0451576_0000447
279 Ga0451576_0047550
280 Ga0451576_0138209
281 Ga0451576_0152320
282 Ga0451576_0398853
283 Ga0466967_1348337
284 Ga0495594_0032542
285 Ga0495581_0226764
286 Ga0496106_0543439
287 Ga0501031_0031931
288 Ga0501033_0069381
289 Ga0501036_0174557
290 Ga0501038_0026262
291 Ga0501039_0005195
292 Ga0501039_0025702
293 Ga0501040_0221985
294 Ga0501040_0248747
295 Ga0501041_0010775
296 Ga0501042_0013063
297 Ga0501042_0177511
298 Ga0501048_0055827
299 Ga0501048_0225699
300 Ga0501068_0491825
301 Ga0501071_0180422
302 Ga0501072_0048578
303 Ga0501072_0140164
304 Ga0501075_0012048
305 Ga0501075_0053490
306 Ga0501075_0226943
307 Ga0501076_0022297
308 Ga0501076_0028713
309 Ga0501076_0048114
310 Ga0501077_0002594
311 Ga0501079_0142887
312 Ga0501079_0318856
313 Ga0501081_0215121
314 Ga0501081_0222580
315 Ga0501035_0150485
316 Ga0501045_0002972
317 nmdc:mga05p37_1214214_c1
318 nmdc:mga05p37_125064_c1
319 nmdc:mga05p37_1702_c1
320 nmdc:mga05p37_227103_c1
321 nmdc:mga05p37_671274_c1
322 nmdc:mga05p37_784409_c1
323 nmdc:mga05p37_78562_c1
324 nmdc:mga09592_56857_c1
325 nmdc:mga06r32_393136_c1
326 nmdc:mga06r32_480723_c1
327 nmdc:mga06r32_68339_c1
328 nmdc:mga08y16_1050122_c1
329 nmdc:mga08y16_170854_c1
330 nmdc:mga0n895_103041_c1
331 nmdc:mga0n895_17201_c1
332 nmdc:mga0n895_18815_c1
333 nmdc:mga0n895_293648_c1
334 nmdc:mga0n895_372079_c1
335 nmdc:mga0rr50_244461_c1
336 nmdc:mga0rr50_526574_c1
337 nmdc:mga0rr50_56166_c1
338 nmdc:mga0rr50_67927_c1
339 nmdc:mga08x19_14545_c1
340 nmdc:mga08x19_490397_c1
341 nmdc:mga0a205_150636_c1
342 nmdc:mga0a205_247164_c1
343 nmdc:mga0a205_281915_c1
344 nmdc:mga0a205_35064_c1
345 nmdc:mga0a205_71873_c1
346 nmdc:mga0a205_779781_c1
347 Ga0495619_0466395
348 Ga0501084_0013433
349 Ga0501084_0027142
350 Ga0501084_0082849
351 Ga0501082_0015500
352 Ga0501082_0082007
353 Ga0501082_0088331
354 Ga0530510_0060700

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

30

76

0.97

PF12802

MarR_2

MarR family

30

84

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hso-assembly1.cif.gz_D crystal structure of mycobacterium tuberculosis marr family protein rv2887 complex with dna 0.8823 10 92
1lnw-assembly3.cif.gz_F crystal structure of the mexr repressor of the mexab-oprm multidrug efflux operon of pseudomonas aeruginosa 0.8815 9 84
5x80-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis marr family protein rv2887 complex with salicylic acid 0.8753 9 92
1lnw-assembly1.cif.gz_B crystal structure of the mexr repressor of the mexab-oprm multidrug efflux operon of pseudomonas aeruginosa 0.8717 11 84
7l19-assembly2.cif.gz_C crystal structure of the marr family transcriptional regulator from enterobacter soli strain lf7 bound to indole 3 acetic acid 0.8671 9 92
ID Description Score Start End Superfamily
af_P76034_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9386 9 53 1.10.10.10
af_P0ACL0_1_57_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9337 6 53 1.10.10.10
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9224 9 72 1.10.10.10
4i02B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9176 23 53 1.10.10.10
af_P33020_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9134 9 53 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A534S374-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.959 1 77
AF-A0A1W9J6Z0-F1-model_v4 Uncharacterized protein 0.9505 95 198
AF-A0A1V4XZA3-F1-model_v4 MarR family protein 0.9432 6 112
AF-A0A496RY91-F1-model_v4 MarR family EPS-associated transcriptional regulator 0.9422 6 112
AF-A0A2G9YIX9-F1-model_v4 MarR family EPS-associated transcriptional regulator 0.9355 7 107

Map