F270566

General Info

Members Datasets Scaffolds Average Seq Length
177 110 163 207

Family's Representative Sequence

Representative Sequence 3300036647|Ga0316582_0458034|Ga0316582_0458034_38_751
Length 237
Sequence LPLAFIPYSLIYNAGIAPETVYPFMGISFDRSYFMGGMTIKTLWIAIYAGVLIWSVIHPKDLFTWFLEVFPALIGALVLAVTYKSFRLTPLVYSLILFHCIILMVGGHYTYAEVPLFDYLKDFLGTTRNDYDKLGHFAQGFVPAMIAREIVIRKQVIRGAAWQAFFIVCACLAISAFYELVEWWVAVATGTGAEAFLGTQGYIWDTQSDMATALVGAISALALLSKWHNNQLAKIKT

Samples

Sample ID Description Type Environment
1 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
2 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
3 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
4 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
5 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
6 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
7 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
8 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
9 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
10 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
11 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
12 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
51 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
52 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
55 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
56 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
57 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
58 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
64 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
67 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
68 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
69 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
71 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
72 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
75 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
78 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
81 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
89 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
90 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
91 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
92 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
93 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
94 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
95 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
98 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
99 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
100 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
101 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
102 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
103 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
104 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
105 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
106 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
107 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
108 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
109 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified
110 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.83
Metatranscriptomes 2.26
Isolates 7.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.69
Nodule 0
Rhizoplane 0.56
Rhizosphere 90.4
Stem 0
Stem Tuber 0
Unclassified 7.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10071991 3300005288 Bacteria 3454
2 Ga0065715_10001801 3300005293 Bacteria 9124
3 Ga0065715_10482540 3300005293 Bacteria 796
4 Ga0065707_10330587 3300005295 Bacteria 950
5 Ga0070683_100031566 3300005329 Bacteria 4819
6 Ga0070661_100185574 3300005344 Unclassified 1584
7 Ga0070703_10037640 3300005406 Unclassified 1491
8 Ga0070709_10146100 3300005434 Bacteria 1629
9 Ga0070714_100424129 3300005435 Bacteria 1260
10 Ga0070713_100406301 3300005436 Bacteria 1272
11 Ga0070711_100009173 3300005439 Bacteria 6081
12 Ga0070711_100422539 3300005439 Bacteria 1086
13 Ga0070708_100000105 3300005445 Bacteria 55760
14 Ga0070706_100136452 3300005467 Unclassified 2290
15 Ga0070684_100005955 3300005535 Bacteria 9392
16 Ga0070664_100790912 3300005564 Bacteria 887
17 Ga0081539_10283658 3300005985 Bacteria 719
18 Ga0070715_10055619 3300006163 Bacteria 1718
19 Ga0070716_100010609 3300006173 Bacteria 4623
20 Ga0070712_100051267 3300006175 Bacteria 2874
21 Ga0105240_10000758 3300009093 Bacteria 58931
22 Ga0105240_10133697 3300009093 Bacteria 2972
23 Ga0105240_10592079 3300009093 Bacteria 1222
24 Ga0105245_10001601 3300009098 Bacteria 20595
25 Ga0114129_10879391 3300009147 Unclassified 1137
26 Ga0105242_10304603 3300009176 Unclassified 1456
27 Ga0105237_10114173 3300009545 Unclassified 2694
28 Ga0105249_11375636 3300009553 Bacteria 778
29 Ga0157373_10007539 3300013100 Bacteria 8089
30 Ga0157372_10001129 3300013307 Bacteria 28993
31 Ga0207705_10749078 3300025909 Bacteria 759
32 Ga0207695_10110364 3300025913 Bacteria 2731
33 Ga0207695_10668756 3300025913 Bacteria 919
34 Ga0207671_10210306 3300025914 Unclassified 1521
35 Ga0207693_10221381 3300025915 Bacteria 1487
36 Ga0207663_10186352 3300025916 Bacteria 1486
37 Ga0207687_10007432 3300025927 Bacteria 7213
38 Ga0207700_10374069 3300025928 Bacteria 1245
39 Ga0207665_10175064 3300025939 Bacteria 1551
40 Ga0207661_10437697 3300025944 Unclassified 1189
41 Ga0207667_10010002 3300025949 Bacteria 11123
42 Ga0265338_10008244 3300028800 Bacteria 12692
43 Ga0265316_10001029 3300031344 Bacteria 30211
44 Ga0316575_10058276 3300031665 Bacteria 1541
45 Ga0316575_10089801 3300031665 Bacteria 1244
46 Ga0316579_10144852 3300031691 Unclassified 1146
47 Ga0316579_10255084 3300031691 Bacteria 848
48 Ga0316576_10003580 3300031727 Bacteria 9153
49 Ga0316576_10022471 3300031727 Bacteria 4381
50 Ga0316576_10053857 3300031727 Bacteria 2933
51 Ga0316576_10053874 3300031727 Bacteria 2932
52 Ga0316576_10086120 3300031727 Bacteria 2336
53 Ga0316576_10147123 3300031727 Bacteria 1775
54 Ga0316576_10147230 3300031727 Bacteria 1774
55 Ga0316576_10207208 3300031727 Bacteria 1476
56 Ga0316576_10221104 3300031727 Bacteria 1425
57 Ga0316576_10226045 3300031727 Unclassified 1407
58 Ga0316576_10402755 3300031727 Bacteria 1014
59 Ga0316576_10441754 3300031727 Unclassified 961
60 Ga0316576_10464942 3300031727 Bacteria 933
61 Ga0316578_10011598 3300031728 Bacteria 4619
62 Ga0316578_10067230 3300031728 Bacteria 2118
63 Ga0316578_10096824 3300031728 Bacteria 1767
64 Ga0316578_10148362 3300031728 Bacteria 1413
65 Ga0307516_10195254 3300031730 Bacteria 1747
66 Ga0316577_10031148 3300031733 Bacteria 2980
67 Ga0316577_10114806 3300031733 Bacteria 1512
68 Ga0307413_10001078 3300031824 Bacteria 9955
69 Ga0307413_10199386 3300031824 Bacteria 1444
70 Ga0307410_10002051 3300031852 Bacteria 9522
71 Ga0307406_10036353 3300031901 Bacteria 3034
72 Ga0307407_10022368 3300031903 Unclassified 3279
73 Ga0307407_10080441 3300031903 Bacteria 1969
74 Ga0307412_10383307 3300031911 Bacteria 1139
75 Ga0307409_100014145 3300031995 Bacteria 5174
76 Ga0307409_100466429 3300031995 Bacteria 1222
77 Ga0307414_10128652 3300032004 Bacteria 1962
78 Ga0307411_10006091 3300032005 Bacteria 5997
79 Ga0307415_100018994 3300032126 Bacteria 4164
80 Ga0316583_10007245 3300032133 Bacteria 3992
81 Ga0316585_10035823 3300032137 Bacteria 1572
82 Ga0316585_10041180 3300032137 Bacteria 1472
83 Ga0316580_10012729 3300032139 Bacteria 2564
84 Ga0316593_10009496 3300032168 Bacteria 2750
85 Ga0316593_10013460 3300032168 Bacteria 2423
86 Ga0316593_10019287 3300032168 Bacteria 2106
87 Ga0316593_10074772 3300032168 Bacteria 1175
88 Ga0373953_0008817 3300035117 Bacteria 3440
89 Ga0373956_0008475 3300035119 Bacteria 4162
90 Ga0373957_0069418 3300035120 Bacteria 1376
91 Ga0373955_0001162 3300035172 Bacteria 11176
92 Ga0316574_0001190 3300035398 Bacteria 12070
93 Ga0316574_0003055 3300035398 Bacteria 8534
94 Ga0316574_0023486 3300035398 Archaea 3681
95 Ga0316574_0031740 3300035398 Bacteria 3206
96 Ga0316574_0041466 3300035398 Bacteria 2838
97 Ga0316574_0043067 3300035398 Bacteria 2788
98 Ga0316574_0052007 3300035398 Bacteria 2554
99 Ga0316574_0102734 3300035398 Bacteria 1830
100 Ga0316574_0103282 3300035398 Bacteria 1825
101 Ga0316574_0112654 3300035398 Bacteria 1744
102 Ga0316574_0176394 3300035398 Bacteria 1375
103 Ga0316574_0205204 3300035398 Bacteria 1265
104 Ga0316574_0206789 3300035398 Bacteria 1260
105 Ga0316574_0458522 3300035398 Bacteria 798
106 Ga0316574_0513006 3300035398 Bacteria 747
107 Ga0373924_0064454 3300035410 Bacteria 1538
108 Ga0373937_0000545 3300036401 Bacteria 33554
109 Ga0373937_0474947 3300036401 Bacteria 1188
110 Ga0373937_0606144 3300036401 Bacteria 1039
111 Ga0316582_0063910 3300036647 Bacteria 2366
112 Ga0316582_0261369 3300036647 Bacteria 1187
113 Ga0316582_0335817 3300036647 Bacteria 1039
114 Ga0316582_0458034 3300036647 Bacteria 879
115 Ga0316584_0007938 3300036712 Bacteria 7280
116 Ga0316584_0017672 3300036712 Bacteria 5134
117 Ga0316584_0023729 3300036712 Bacteria 4482
118 Ga0316584_0038676 3300036712 Bacteria 3550
119 Ga0316584_0055263 3300036712 Unclassified 2973
120 Ga0316584_0082867 3300036712 Bacteria 2402
121 Ga0316584_0140792 3300036712 Bacteria 1799
122 Ga0316584_0190696 3300036712 Bacteria 1515
123 Ga0316584_0231431 3300036712 Bacteria 1355
124 Ga0316584_0357044 3300036712 Bacteria 1048
125 Ga0316584_0374227 3300036712 Bacteria 1019
126 Ga0316584_0547491 3300036712 Bacteria 808
127 Ga0395905_0012008 3300037471 Bacteria 8353
128 Ga0395905_0078681 3300037471 Bacteria 3090
129 Ga0395905_0362451 3300037471 Bacteria 1342
130 Ga0316581_0093433 3300037588 Bacteria 926
131 Ga0451853_2023988 3300041512 Bacteria 751
132 Ga0451577_0102533 3300042876 Bacteria 2557
133 Ga0453683_0385289 3300044673 Bacteria 903
134 Ga0453684_0000033 3300044712 Bacteria 734012
135 Ga0453684_0021629 3300044712 Bacteria 9595
136 Ga0453684_0070330 3300044712 Bacteria 4432
137 Ga0451576_0000171 3300045051 Bacteria 162452
138 Ga0451576_0000655 3300045051 Bacteria 71505
139 Ga0451576_0012001 3300045051 Bacteria 9784
140 Ga0495651_0088817 3300046462 Bacteria 2322
141 Ga0495628_0037417 3300046516 Bacteria 3891
142 Ga0495587_0006679 3300046536 Bacteria 7513
143 Ga0495645_0000105 3300046543 Bacteria 58445
144 Ga0495668_0000562 3300046616 Bacteria 45637
145 Ga0495599_0005062 3300046678 Bacteria 7847
146 Ga0495623_0210126 3300046679 Bacteria 1114
147 Ga0495600_0067157 3300046809 Bacteria 2344
148 Ga0495674_0122601 3300047319 Bacteria 2195
149 Ga0495675_0000533 3300047444 Bacteria 24653
150 Ga0496112_0027500 3300048915 Bacteria 5484
151 Ga0501298_027803 3300049521 Bacteria 1095
152 Ga0501073_0241750 3300049589 Bacteria 1247
153 Ga0501073_0279248 3300049589 Bacteria 1152
154 Ga0501074_0308467 3300049590 Bacteria 1124
155 Ga0501076_0232868 3300049592 Bacteria 1506
156 Ga0501249_000019 3300049679 Bacteria 104107
157 Ga0501245_034263 3300049708 Bacteria 851
158 Ga0501083_0241823 3300049744 Bacteria 1175
159 Ga0501241_002387 3300049758 Unclassified 3632
160 Ga0500641_0002395 3300053096 Bacteria 6650
161 Ga0500642_0020258 3300053130 Bacteria 2611
162 Ga0500616_0012351 3300053153 Bacteria 5001
163 Ga0501084_0037762 3300054114 Bacteria 4036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032004 Ga0307414_10128652 Ga0307414_101286523 173
2 3300041512 Ga0451853_2023988 Ga0451853_2023988_31_645 186
3 3300036647 Ga0316582_0261369 Ga0316582_0261369_154_813 189
4 iso_pu_bacteria 2881955468 2881956418 194
5 3300031727 Ga0316576_10053857 Ga0316576_100538573 195
6 3300032168 Ga0316593_10009496 Ga0316593_100094963 195
7 3300046616 Ga0495668_0000562 Ga0495668_0000562_37021_37608 195
8 iso_pu_bacteria 2956897341 2956899936 195
9 3300009176 Ga0105242_10304603 Ga0105242_103046032 196
10 3300009553 Ga0105249_11375636 Ga0105249_113756362 196
11 3300031727 Ga0316576_10441754 Ga0316576_104417542 196
12 iso_pu_bacteria 2513020052 2513232140 196
13 iso_pu_bacteria 2643221667 2644372024 196
14 iso_pu_bacteria 2738541279 2738734647 196
15 iso_pu_bacteria 2738541285 2738767406 196
16 iso_pu_bacteria 2738543007 2739216229 196
17 iso_pu_bacteria 2929150217 2929153747 196
18 iso_pu_bacteria 646564506 646812446 196
19 3300005295 Ga0065707_10330587 Ga0065707_103305871 197
20 3300031727 Ga0316576_10147230 Ga0316576_101472302 197
21 3300035398 Ga0316574_0102734 Ga0316574_0102734_747_1340 197
22 iso_pu_bacteria 2919688452 2919692301 197
23 3300005293 Ga0065715_10482540 Ga0065715_104825401 198
24 3300031665 Ga0316575_10058276 Ga0316575_100582763 198
25 3300031727 Ga0316576_10053874 Ga0316576_100538744 198
26 3300031728 Ga0316578_10067230 Ga0316578_100672303 198
27 3300031733 Ga0316577_10114806 Ga0316577_101148062 198
28 3300031911 Ga0307412_10383307 Ga0307412_103833072 198
29 3300032139 Ga0316580_10012729 Ga0316580_100127293 198
30 3300032168 Ga0316593_10019287 Ga0316593_100192873 198
31 3300035398 Ga0316574_0001190 Ga0316574_0001190_2367_2963 198
32 3300035398 Ga0316574_0513006 Ga0316574_0513006_127_723 198
33 3300049589 Ga0501073_0241750 Ga0501073_0241750_619_1215 198
34 3300049758 Ga0501241_002387 Ga0501241_002387_1095_1691 198
35 3300054114 Ga0501084_0037762 Ga0501084_0037762_401_997 198
36 iso_pu_bacteria 2919497567 2919497947 198
37 3300005344 Ga0070661_100185574 Ga0070661_1001855742 199
38 3300009093 Ga0105240_10000758 Ga0105240_1000075831 199
39 3300032168 Ga0316593_10074772 Ga0316593_100747721 199
40 3300035398 Ga0316574_0031740 Ga0316574_0031740_2529_3128 199
41 3300037471 Ga0395905_0012008 Ga0395905_0012008_5012_5611 199
42 3300044712 Ga0453684_0070330 Ga0453684_0070330_3429_4028 199
43 3300049590 Ga0501074_0308467 Ga0501074_0308467_479_1081 199
44 3300031665 Ga0316575_10089801 Ga0316575_100898011 200
45 3300031691 Ga0316579_10144852 Ga0316579_101448523 200
46 3300031727 Ga0316576_10003580 Ga0316576_100035808 200
47 3300031727 Ga0316576_10022471 Ga0316576_100224714 200
48 3300031727 Ga0316576_10147123 Ga0316576_101471232 200
49 3300031727 Ga0316576_10207208 Ga0316576_102072083 200
50 3300031727 Ga0316576_10221104 Ga0316576_102211041 200
51 3300031727 Ga0316576_10226045 Ga0316576_102260451 200
52 3300031727 Ga0316576_10402755 Ga0316576_104027552 200
53 3300031727 Ga0316576_10464942 Ga0316576_104649421 200
54 3300031728 Ga0316578_10096824 Ga0316578_100968242 200
55 3300031728 Ga0316578_10148362 Ga0316578_101483623 200
56 3300031730 Ga0307516_10195254 Ga0307516_101952542 200
57 3300031733 Ga0316577_10031148 Ga0316577_100311484 200
58 3300032137 Ga0316585_10035823 Ga0316585_100358232 200
59 3300032168 Ga0316593_10013460 Ga0316593_100134602 200
60 3300035398 Ga0316574_0003055 Ga0316574_0003055_5182_5790 200
61 3300035398 Ga0316574_0023486 Ga0316574_0023486_958_1593 200
62 3300035398 Ga0316574_0041466 Ga0316574_0041466_209_817 200
63 3300035398 Ga0316574_0043067 Ga0316574_0043067_555_1166 200
64 3300035398 Ga0316574_0052007 Ga0316574_0052007_139_741 200
65 3300035398 Ga0316574_0103282 Ga0316574_0103282_1056_1682 200
66 3300035398 Ga0316574_0176394 Ga0316574_0176394_269_904 200
67 3300035398 Ga0316574_0205204 Ga0316574_0205204_322_930 200
68 3300035398 Ga0316574_0206789 Ga0316574_0206789_467_1081 200
69 3300035398 Ga0316574_0458522 Ga0316574_0458522_85_690 200
70 3300036647 Ga0316582_0458034 Ga0316582_0458034_38_751 200
71 3300036712 Ga0316584_0017672 Ga0316584_0017672_887_1495 200
72 3300036712 Ga0316584_0038676 Ga0316584_0038676_1904_2521 200
73 3300036712 Ga0316584_0055263 Ga0316584_0055263_507_1115 200
74 3300036712 Ga0316584_0082867 Ga0316584_0082867_1507_2166 200
75 3300036712 Ga0316584_0190696 Ga0316584_0190696_833_1468 200
76 3300036712 Ga0316584_0231431 Ga0316584_0231431_153_770 200
77 3300036712 Ga0316584_0374227 Ga0316584_0374227_201_830 200
78 3300042876 Ga0451577_0102533 Ga0451577_0102533_1491_2093 200
79 3300045051 Ga0451576_0012001 Ga0451576_0012001_6150_6752 200
80 3300049592 Ga0501076_0232868 Ga0501076_0232868_381_983 200
81 3300049679 Ga0501249_000019 Ga0501249_000019_88063_88665 200
82 3300053096 Ga0500641_0002395 Ga0500641_0002395_2227_2829 200
83 iso_pu_bacteria 2929206907 2929211723 200
84 3300009545 Ga0105237_10114173 Ga0105237_101141732 201
85 3300013100 Ga0157373_10007539 Ga0157373_100075392 201
86 3300025914 Ga0207671_10210306 Ga0207671_102103062 201
87 3300032137 Ga0316585_10041180 Ga0316585_100411802 201
88 3300036712 Ga0316584_0007938 Ga0316584_0007938_1305_1913 201
89 3300037471 Ga0395905_0362451 Ga0395905_0362451_167_811 201
90 3300044673 Ga0453683_0385289 Ga0453683_0385289_207_824 201
91 3300044712 Ga0453684_0021629 Ga0453684_0021629_5581_6186 201
92 3300049589 Ga0501073_0279248 Ga0501073_0279248_162_770 201
93 3300053130 Ga0500642_0020258 Ga0500642_0020258_928_1563 201
94 iso_pu_bacteria 2728369097 2729147776 201
95 3300005288 Ga0065714_10071991 Ga0065714_100719912 202
96 3300005293 Ga0065715_10001801 Ga0065715_100018017 202
97 3300005329 Ga0070683_100031566 Ga0070683_1000315661 202
98 3300005406 Ga0070703_10037640 Ga0070703_100376403 202
99 3300005434 Ga0070709_10146100 Ga0070709_101461002 202
100 3300005435 Ga0070714_100424129 Ga0070714_1004241291 202
101 3300005436 Ga0070713_100406301 Ga0070713_1004063012 202
102 3300005439 Ga0070711_100009173 Ga0070711_1000091733 202
103 3300005439 Ga0070711_100422539 Ga0070711_1004225392 202
104 3300005445 Ga0070708_100000105 Ga0070708_10000010527 202
105 3300005467 Ga0070706_100136452 Ga0070706_1001364522 202
106 3300005535 Ga0070684_100005955 Ga0070684_1000059556 202
107 3300005564 Ga0070664_100790912 Ga0070664_1007909122 202
108 3300005985 Ga0081539_10283658 Ga0081539_102836581 202
109 3300006163 Ga0070715_10055619 Ga0070715_100556192 202
110 3300006173 Ga0070716_100010609 Ga0070716_1000106093 202
111 3300006175 Ga0070712_100051267 Ga0070712_1000512673 202
112 3300009093 Ga0105240_10133697 Ga0105240_101336973 202
113 3300009093 Ga0105240_10592079 Ga0105240_105920792 202
114 3300009098 Ga0105245_10001601 Ga0105245_1000160116 202
115 3300009147 Ga0114129_10879391 Ga0114129_108793911 202
116 3300013307 Ga0157372_10001129 Ga0157372_100011299 202
117 3300025909 Ga0207705_10749078 Ga0207705_107490781 202
118 3300025913 Ga0207695_10110364 Ga0207695_101103643 202
119 3300025913 Ga0207695_10668756 Ga0207695_106687562 202
120 3300025915 Ga0207693_10221381 Ga0207693_102213811 202
121 3300025916 Ga0207663_10186352 Ga0207663_101863523 202
122 3300025927 Ga0207687_10007432 Ga0207687_100074326 202
123 3300025928 Ga0207700_10374069 Ga0207700_103740691 202
124 3300025939 Ga0207665_10175064 Ga0207665_101750641 202
125 3300025944 Ga0207661_10437697 Ga0207661_104376972 202
126 3300025949 Ga0207667_10010002 Ga0207667_100100028 202
127 3300028800 Ga0265338_10008244 Ga0265338_100082446 202
128 3300031344 Ga0265316_10001029 Ga0265316_1000102927 202
129 3300031691 Ga0316579_10255084 Ga0316579_102550842 202
130 3300031727 Ga0316576_10086120 Ga0316576_100861202 202
131 3300031728 Ga0316578_10011598 Ga0316578_100115984 202
132 3300031824 Ga0307413_10001078 Ga0307413_1000107810 202
133 3300031824 Ga0307413_10199386 Ga0307413_101993861 202
134 3300031852 Ga0307410_10002051 Ga0307410_100020518 202
135 3300031901 Ga0307406_10036353 Ga0307406_100363532 202
136 3300031903 Ga0307407_10022368 Ga0307407_100223682 202
137 3300031903 Ga0307407_10080441 Ga0307407_100804412 202
138 3300031995 Ga0307409_100014145 Ga0307409_1000141453 202
139 3300031995 Ga0307409_100466429 Ga0307409_1004664291 202
140 3300032005 Ga0307411_10006091 Ga0307411_100060915 202
141 3300032126 Ga0307415_100018994 Ga0307415_1000189942 202
142 3300032133 Ga0316583_10007245 Ga0316583_100072451 202
143 3300035117 Ga0373953_0008817 Ga0373953_0008817_476_1099 202
144 3300035119 Ga0373956_0008475 Ga0373956_0008475_2867_3490 202
145 3300035120 Ga0373957_0069418 Ga0373957_0069418_591_1214 202
146 3300035172 Ga0373955_0001162 Ga0373955_0001162_5042_5665 202
147 3300035398 Ga0316574_0112654 Ga0316574_0112654_805_1449 202
148 3300035410 Ga0373924_0064454 Ga0373924_0064454_183_821 202
149 3300036401 Ga0373937_0000545 Ga0373937_0000545_12157_12780 202
150 3300036401 Ga0373937_0474947 Ga0373937_0474947_481_1134 202
151 3300036401 Ga0373937_0606144 Ga0373937_0606144_182_814 202
152 3300036647 Ga0316582_0063910 Ga0316582_0063910_1647_2285 202
153 3300036647 Ga0316582_0335817 Ga0316582_0335817_315_959 202
154 3300036712 Ga0316584_0023729 Ga0316584_0023729_2188_2835 202
155 3300036712 Ga0316584_0140792 Ga0316584_0140792_913_1626 202
156 3300036712 Ga0316584_0357044 Ga0316584_0357044_99_737 202
157 3300036712 Ga0316584_0547491 Ga0316584_0547491_57_752 202
158 3300037471 Ga0395905_0078681 Ga0395905_0078681_542_1168 202
159 3300037588 Ga0316581_0093433 Ga0316581_0093433_210_848 202
160 3300044712 Ga0453684_0000033 Ga0453684_0000033_605996_606628 202
161 3300045051 Ga0451576_0000171 Ga0451576_0000171_93886_94539 202
162 3300045051 Ga0451576_0000655 Ga0451576_0000655_23356_24015 202
163 3300046462 Ga0495651_0088817 Ga0495651_0088817_1144_1767 202
164 3300046516 Ga0495628_0037417 Ga0495628_0037417_1336_1959 202
165 3300046536 Ga0495587_0006679 Ga0495587_0006679_2923_3546 202
166 3300046543 Ga0495645_0000105 Ga0495645_0000105_20776_21399 202
167 3300046678 Ga0495599_0005062 Ga0495599_0005062_4986_5609 202
168 3300046679 Ga0495623_0210126 Ga0495623_0210126_331_954 202
169 3300046809 Ga0495600_0067157 Ga0495600_0067157_347_970 202
170 3300047319 Ga0495674_0122601 Ga0495674_0122601_1213_1884 202
171 3300047444 Ga0495675_0000533 Ga0495675_0000533_11125_11748 202
172 3300048915 Ga0496112_0027500 Ga0496112_0027500_2415_3050 202
173 3300049521 Ga0501298_027803 Ga0501298_027803_202_858 202
174 3300049708 Ga0501245_034263 Ga0501245_034263_194_829 202
175 3300049744 Ga0501083_0241823 Ga0501083_0241823_398_1009 202
176 3300053153 Ga0500616_0012351 Ga0500616_0012351_4035_4673 202
177 iso_pu_bacteria 8001522603 8001524240 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09997

DUF2238

Predicted membrane protein (DUF2238)

73

213

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y8a-assembly1.cif.gz_L cryo-em structure of cryptophyte photosystem i 0.6145 93 194
3sjr-assembly2.cif.gz_C crystal structure of conserved unkown function protein cv_1783 from chromobacterium violaceum atcc 12472 0.5762 79 186
6tcl-assembly1.cif.gz_L1 photosystem i tetramer 0.5709 95 190
7blz-assembly1.cif.gz_L red alga c.merolae photosystem i 0.5682 95 188
7qco-assembly1.cif.gz_L the structure of photosystem i tetramer from chroococcidiopsis ts-821, a thermophilic, unicellular, non-heterocyst-forming cyanobacterium 0.542 95 191
ID Description Score Start End Superfamily
af_P39270_42_182_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.9276 37 175 1.20.144.10
af_P39270_42_182_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.9086 37 175 1.20.144.10
af_Q9AST5_29_108_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6029 95 183 1.20.140.150
af_Q9AST5_29_108_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.567 95 183 1.20.140.150
af_B4FUT9_48_211_1.20.1240.10 Mainly Alpha;Up-down Bundle;Photosystem 1 Reaction Centre Subunit Xi; Chain: L;;Photosystem I PsaL, reaction centre subunit XI 0.5517 95 187 1.20.1240.10
ID Description Score Start End GO Terms
AF-A0A2M7D0C7-F1-model_v4 DUF2238 domain-containing protein 0.9822 31 197 GO:0016020
AF-A0A2N2E7J8-F1-model_v4 DUF2238 domain-containing protein 0.9754 5 201 GO:0016020
AF-A0A6B2KW86-F1-model_v4 DUF2238 domain-containing protein 0.9753 12 198 GO:0016020
AF-A0A0F9MBG7-F1-model_v4 DUF2238 domain-containing protein 0.9741 4 114 GO:0016020
AF-A0A3B9BI86-F1-model_v4 DUF2238 domain-containing protein 0.972 6 116 GO:0016020

Feature Viewer

pLDDT pTM Quality
90.32 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map