F270234

General Info

Members Datasets Scaffolds Average Seq Length
177 107 176 271

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10020638|Ga0157372_100206384
Length 307
Sequence MNIFAEKPMPRQNHSIACLPISRTRSGRRSATAWLAYTAIAISFFAACSSRKFIPFPKTPGPAVTGSEFYRTVAAWHWKERDSLAVQLVLSGDVPAFLHHFVCIRTSIADSATGKKINARYYVAPDYLSIGSDDDWARTPLTPMAAQKIADSLDCFLPTRKMVNDIYEQAIVKLAPVPMYAFRDSSVTMWQHHLIVEGQRKGRKGLIAGIKKDVVISGKIPRDAKPDRVAIYGWHRLTGDPIQPLYTGHVDWYVDYSHGIRLVYRTIFVNGKAMDYVDVLKNPALSRLLCDEDSCDFYRYPLQTGAN

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
106 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
107 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.69
Nodule 0
Rhizoplane 0
Rhizosphere 92.66
Stem 0
Stem Tuber 0
Unclassified 5.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5615711 2162886012 Unclassified 2858
2 rootH2_10009135 3300003320 Bacteria 10334
3 rootL2_10019365 3300003322 Bacteria 3754
4 rootH1_10017855 3300003323 Bacteria 35757
5 Ga0065712_10071492 3300005290 Bacteria 5221
6 Ga0065715_10089266 3300005293 Bacteria 11762
7 Ga0065707_10258336 3300005295 Bacteria 1104
8 Ga0070658_10013653 3300005327 Bacteria 6517
9 Ga0070658_10182503 3300005327 Bacteria 1766
10 Ga0070683_100353480 3300005329 Bacteria 1399
11 Ga0070680_100019298 3300005336 Bacteria 5402
12 Ga0070680_100036111 3300005336 Bacteria 3993
13 Ga0070680_100064951 3300005336 Bacteria 2991
14 Ga0070682_100048355 3300005337 Bacteria 2648
15 Ga0070660_100062307 3300005339 Bacteria 2897
16 Ga0070687_100165399 3300005343 Bacteria 1312
17 Ga0070661_100003070 3300005344 Bacteria 11488
18 Ga0070671_100048885 3300005355 Bacteria 3519
19 Ga0070673_100140451 3300005364 Unclassified 2037
20 Ga0070659_100191697 3300005366 Bacteria 1680
21 Ga0070681_10020423 3300005458 Bacteria 6638
22 Ga0070681_10066637 3300005458 Bacteria 3569
23 Ga0070681_10357951 3300005458 Unclassified 1370
24 Ga0070685_10018104 3300005466 Bacteria 3784
25 Ga0070679_100000174 3300005530 Bacteria 51897
26 Ga0070679_100001499 3300005530 Bacteria 20743
27 Ga0070684_100003150 3300005535 Bacteria 12313
28 Ga0070684_100010168 3300005535 Bacteria 7442
29 Ga0068853_100070800 3300005539 Bacteria 3036
30 Ga0070695_100002409 3300005545 Bacteria 10746
31 Ga0068855_100000995 3300005563 Bacteria 35281
32 Ga0068855_100006218 3300005563 Bacteria 14548
33 Ga0068855_100032788 3300005563 Bacteria 6201
34 Ga0068855_100438757 3300005563 Bacteria 1426
35 Ga0070664_100010422 3300005564 Bacteria 7537
36 Ga0068856_100110119 3300005614 Unclassified 2751
37 Ga0068856_100418318 3300005614 Bacteria 1360
38 Ga0068852_100034775 3300005616 Bacteria 4196
39 Ga0068852_100039686 3300005616 Bacteria 3965
40 Ga0068859_100154671 3300005617 Bacteria 2370
41 Ga0068864_100061670 3300005618 Bacteria 3248
42 Ga0068863_100034542 3300005841 Bacteria 4816
43 Ga0068863_100214344 3300005841 Bacteria 1854
44 Ga0068858_100105682 3300005842 Bacteria 2627
45 Ga0075428_100367056 3300006844 Bacteria 1544
46 Ga0075430_100002881 3300006846 Bacteria 14402
47 Ga0075431_100158712 3300006847 Bacteria 2326
48 Ga0097620_100154666 3300006931 Bacteria 2370
49 Ga0105240_10043740 3300009093 Bacteria 5695
50 Ga0105241_10029228 3300009174 Bacteria 4110
51 Ga0105241_10285166 3300009174 Bacteria 1412
52 Ga0105242_10023093 3300009176 Bacteria 4902
53 Ga0105248_10132575 3300009177 Bacteria 2811
54 Ga0105237_10191797 3300009545 Bacteria 2043
55 Ga0105238_10177356 3300009551 Bacteria 2108
56 Ga0105249_10004791 3300009553 Bacteria 11679
57 Ga0105249_10034354 3300009553 Bacteria 4595
58 Ga0105249_10608423 3300009553 Bacteria 1148
59 Ga0105239_10941131 3300010375 Bacteria 992
60 Ga0157373_10008405 3300013100 Bacteria 7664
61 Ga0157373_10021725 3300013100 Bacteria 4657
62 Ga0157373_10080959 3300013100 Unclassified 2290
63 Ga0157373_10130356 3300013100 Unclassified 1768
64 Ga0157371_10000499 3300013102 Bacteria 47558
65 Ga0157371_10019976 3300013102 Bacteria 4933
66 Ga0157370_10000621 3300013104 Bacteria 44144
67 Ga0157369_10008396 3300013105 Bacteria 11844
68 Ga0157369_10146212 3300013105 Unclassified 2499
69 Ga0157369_10181421 3300013105 Unclassified 2215
70 Ga0157374_10285995 3300013296 Unclassified 1628
71 Ga0163162_10146783 3300013306 Bacteria 2475
72 Ga0163162_10298824 3300013306 Bacteria 1742
73 Ga0157372_10015954 3300013307 Bacteria 8056
74 Ga0157372_10020638 3300013307 Bacteria 7109
75 Ga0157372_10020927 3300013307 Bacteria 7061
76 Ga0157372_10022141 3300013307 Bacteria 6875
77 Ga0157372_10088296 3300013307 Bacteria 3520
78 Ga0157372_10114638 3300013307 Bacteria 3089
79 Ga0157372_10147462 3300013307 Bacteria 2713
80 Ga0157375_10045141 3300013308 Unclassified 4288
81 Ga0163163_10011385 3300014325 Bacteria 8063
82 Ga0157380_10012636 3300014326 Bacteria 6128
83 Ga0157377_10044867 3300014745 Unclassified 2467
84 Ga0157376_10085006 3300014969 Bacteria 2725
85 Ga0207656_10012177 3300025321 Bacteria 3266
86 Ga0207656_10058591 3300025321 Unclassified 1683
87 Ga0207647_10000831 3300025904 Bacteria 23995
88 Ga0207705_10012213 3300025909 Bacteria 6207
89 Ga0207705_10092013 3300025909 Bacteria 2222
90 Ga0207705_10168499 3300025909 Bacteria 1648
91 Ga0207707_10001365 3300025912 Bacteria 22660
92 Ga0207707_10011491 3300025912 Bacteria 7710
93 Ga0207707_10169462 3300025912 Unclassified 1908
94 Ga0207695_10000060 3300025913 Bacteria 360217
95 Ga0207660_10097848 3300025917 Bacteria 2187
96 Ga0207660_10109968 3300025917 Bacteria 2072
97 Ga0207660_10195388 3300025917 Bacteria 1578
98 Ga0207662_10009646 3300025918 Bacteria 5320
99 Ga0207657_10011956 3300025919 Bacteria 8590
100 Ga0207657_10088811 3300025919 Unclassified 2583
101 Ga0207649_10013259 3300025920 Bacteria 4596
102 Ga0207652_10000132 3300025921 Bacteria 80345
103 Ga0207652_10000271 3300025921 Bacteria 53923
104 Ga0207650_10012509 3300025925 Bacteria 5858
105 Ga0207650_10110298 3300025925 Bacteria 2129
106 Ga0207659_10208165 3300025926 Bacteria 1566
107 Ga0207689_10029430 3300025942 Bacteria 4585
108 Ga0207661_10000940 3300025944 Bacteria 19172
109 Ga0207661_10003161 3300025944 Bacteria 11421
110 Ga0207661_10028363 3300025944 Unclassified 4286
111 Ga0207661_10197567 3300025944 Bacteria 1767
112 Ga0207661_10577258 3300025944 Bacteria 1031
113 Ga0207679_10003970 3300025945 Bacteria 9193
114 Ga0207679_10057678 3300025945 Bacteria 2873
115 Ga0207667_10000241 3300025949 Bacteria 76753
116 Ga0207667_10039915 3300025949 Bacteria 4999
117 Ga0207667_10057636 3300025949 Bacteria 4077
118 Ga0207667_10345625 3300025949 Bacteria 1517
119 Ga0207651_10117020 3300025960 Bacteria 2013
120 Ga0207712_10000955 3300025961 Bacteria 20837
121 Ga0207712_10003315 3300025961 Bacteria 10203
122 Ga0207640_10088126 3300025981 Bacteria 2142
123 Ga0207703_10097310 3300026035 Bacteria 2486
124 Ga0207639_10016003 3300026041 Bacteria 5297
125 Ga0207639_10030647 3300026041 Unclassified 3946
126 Ga0207639_10503846 3300026041 Unclassified 1107
127 Ga0207708_10118328 3300026075 Unclassified 2063
128 Ga0207702_10016247 3300026078 Bacteria 6159
129 Ga0207702_10370475 3300026078 Bacteria 1375
130 Ga0207641_10054206 3300026088 Bacteria 3402
131 Ga0207676_10048482 3300026095 Bacteria 3298
132 Ga0207675_100078984 3300026118 Bacteria 3083
133 Ga0207683_10442156 3300026121 Bacteria 1198
134 Ga0207698_10002228 3300026142 Bacteria 11462
135 Ga0207698_10002537 3300026142 Bacteria 10842
136 Ga0207698_10109863 3300026142 Bacteria 2308
137 Ga0207698_10221005 3300026142 Bacteria 1712
138 Ga0307513_10067629 3300031456 Bacteria 3747
139 Ga0307513_10365324 3300031456 Bacteria 1187
140 Ga0307408_100474884 3300031548 Bacteria 1090
141 Ga0307508_10001709 3300031616 Bacteria 24361
142 Ga0395899_0006685 3300037312 Bacteria 8935
143 Ga0395899_0011397 3300037312 Bacteria 6808
144 Ga0395899_0033078 3300037312 Bacteria 3884
145 Ga0395899_0050330 3300037312 Bacteria 3093
146 Ga0395899_0238246 3300037312 Bacteria 1253
147 Ga0395900_0007443 3300037418 Bacteria 11310
148 Ga0395900_0040022 3300037418 Bacteria 4830
149 Ga0395900_0087917 3300037418 Bacteria 3194
150 Ga0395900_0224563 3300037418 Unclassified 1891
151 Ga0395898_0002124 3300037466 Bacteria 24470
152 Ga0395898_0002566 3300037466 Bacteria 21273
153 Ga0395898_0242119 3300037466 Bacteria 1720
154 Ga0395901_0001075 3300038443 Bacteria 29195
155 Ga0395901_0010128 3300038443 Bacteria 9552
156 Ga0395901_0146789 3300038443 Bacteria 2479
157 Ga0436365_0174358 3300039437 Bacteria 14690
158 Ga0436365_0274296 3300039437 Bacteria 1971
159 Ga0436361_0561349 3300039447 Bacteria 888
160 Ga0451841_0154501 3300041498 Bacteria 1356
161 Ga0466959_0086788 3300045049 Bacteria 2251
162 Ga0495668_0000751 3300046616 Bacteria 38311
163 Ga0501033_0046175 3300049570 Bacteria 3239
164 Ga0501034_0052389 3300049571 Bacteria 4111
165 Ga0501037_0083724 3300049573 Bacteria 2311
166 Ga0501043_0247115 3300049579 Bacteria 1375
167 Ga0501043_0377569 3300049579 Bacteria 1073
168 Ga0501225_0000486 3300049705 Bacteria 12353
169 Ga0501225_0028394 3300049705 Unclassified 1538
170 Ga0501080_0370203 3300049742 Bacteria 1292
171 Ga0501080_0585303 3300049742 Bacteria 992
172 Ga0501044_0094587 3300049823 Bacteria 3012
173 nmdc:mga06r32_663133_c1 3300050510 Bacteria 1011
174 Ga0500555_070325 3300053103 Bacteria 924
175 Ga0500658_0028679 3300053134 Bacteria 2162
176 Ga0500611_000031 3300053727 Bacteria 85821

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10017855 rootH1_1001785521 229
2 3300041498 Ga0451841_0154501 Ga0451841_0154501_49_741 229
3 3300049705 Ga0501225_0000486 Ga0501225_0000486_1862_2554 229
4 3300053103 Ga0500555_070325 Ga0500555_070325_132_824 229
5 3300053134 Ga0500658_0028679 Ga0500658_0028679_250_942 229
6 3300005295 Ga0065707_10258336 Ga0065707_102583361 245
7 3300046616 Ga0495668_0000751 Ga0495668_0000751_2309_3052 246
8 3300005841 Ga0068863_100034542 Ga0068863_1000345424 247
9 3300026088 Ga0207641_10054206 Ga0207641_100542063 247
10 3300049573 Ga0501037_0083724 Ga0501037_0083724_94_840 247
11 3300049579 Ga0501043_0377569 Ga0501043_0377569_95_841 247
12 3300049742 Ga0501080_0585303 Ga0501080_0585303_84_830 247
13 3300003322 rootL2_10019365 rootL2_100193652 254
14 3300031456 Ga0307513_10067629 Ga0307513_100676292 254
15 3300031456 Ga0307513_10365324 Ga0307513_103653241 254
16 3300025321 Ga0207656_10058591 Ga0207656_100585911 257
17 3300031548 Ga0307408_100474884 Ga0307408_1004748841 259
18 3300009553 Ga0105249_10004791 Ga0105249_1000479110 264
19 3300025961 Ga0207712_10003315 Ga0207712_100033153 264
20 3300003320 rootH2_10009135 rootH2_100091356 266
21 3300014326 Ga0157380_10012636 Ga0157380_100126361 266
22 3300031616 Ga0307508_10001709 Ga0307508_1000170924 266
23 3300005290 Ga0065712_10071492 Ga0065712_100714925 267
24 3300005343 Ga0070687_100165399 Ga0070687_1001653992 267
25 3300005466 Ga0070685_10018104 Ga0070685_100181043 267
26 3300005617 Ga0068859_100154671 Ga0068859_1001546712 267
27 3300005618 Ga0068864_100061670 Ga0068864_1000616702 267
28 3300005841 Ga0068863_100214344 Ga0068863_1002143442 267
29 3300005842 Ga0068858_100105682 Ga0068858_1001056822 267
30 3300006844 Ga0075428_100367056 Ga0075428_1003670561 267
31 3300006931 Ga0097620_100154666 Ga0097620_1001546662 267
32 3300009176 Ga0105242_10023093 Ga0105242_100230935 267
33 3300009177 Ga0105248_10132575 Ga0105248_101325753 267
34 3300009553 Ga0105249_10034354 Ga0105249_100343542 267
35 3300013306 Ga0163162_10146783 Ga0163162_101467832 267
36 3300013306 Ga0163162_10298824 Ga0163162_102988242 267
37 3300013308 Ga0157375_10045141 Ga0157375_100451413 267
38 3300014969 Ga0157376_10085006 Ga0157376_100850062 267
39 3300025918 Ga0207662_10009646 Ga0207662_100096461 267
40 3300025925 Ga0207650_10110298 Ga0207650_101102982 267
41 3300025960 Ga0207651_10117020 Ga0207651_101170201 267
42 3300025961 Ga0207712_10000955 Ga0207712_100009553 267
43 3300026035 Ga0207703_10097310 Ga0207703_100973103 267
44 3300026075 Ga0207708_10118328 Ga0207708_101183282 267
45 3300026095 Ga0207676_10048482 Ga0207676_100484823 267
46 3300026118 Ga0207675_100078984 Ga0207675_1000789843 267
47 3300026121 Ga0207683_10442156 Ga0207683_104421561 267
48 3300039447 Ga0436361_0561349 Ga0436361_0561349_44_850 267
49 3300050510 nmdc:mga06r32_663133_c1 nmdc:mga06r32_663133_c1_182_988 267
50 3300053727 Ga0500611_000031 Ga0500611_000031_81115_81921 267
51 3300005329 Ga0070683_100353480 Ga0070683_1003534802 268
52 3300005336 Ga0070680_100019298 Ga0070680_1000192984 268
53 3300005344 Ga0070661_100003070 Ga0070661_1000030705 268
54 3300005355 Ga0070671_100048885 Ga0070671_1000488853 268
55 3300005364 Ga0070673_100140451 Ga0070673_1001404512 268
56 3300005530 Ga0070679_100000174 Ga0070679_10000017413 268
57 3300005535 Ga0070684_100003150 Ga0070684_1000031507 268
58 3300005535 Ga0070684_100010168 Ga0070684_1000101684 268
59 3300005564 Ga0070664_100010422 Ga0070664_1000104226 268
60 3300005616 Ga0068852_100034775 Ga0068852_1000347754 268
61 3300009174 Ga0105241_10029228 Ga0105241_100292285 268
62 3300009174 Ga0105241_10285166 Ga0105241_102851662 268
63 3300009545 Ga0105237_10191797 Ga0105237_101917972 268
64 3300010375 Ga0105239_10941131 Ga0105239_109411311 268
65 3300013100 Ga0157373_10008405 Ga0157373_100084052 268
66 3300013100 Ga0157373_10021725 Ga0157373_100217252 268
67 3300013105 Ga0157369_10146212 Ga0157369_101462122 268
68 3300013105 Ga0157369_10181421 Ga0157369_101814213 268
69 3300013296 Ga0157374_10285995 Ga0157374_102859953 268
70 3300014325 Ga0163163_10011385 Ga0163163_100113857 268
71 3300014745 Ga0157377_10044867 Ga0157377_100448674 268
72 3300025321 Ga0207656_10012177 Ga0207656_100121771 268
73 3300025904 Ga0207647_10000831 Ga0207647_1000083117 268
74 3300025920 Ga0207649_10013259 Ga0207649_100132594 268
75 3300025921 Ga0207652_10000132 Ga0207652_1000013240 268
76 3300025925 Ga0207650_10012509 Ga0207650_100125096 268
77 3300025926 Ga0207659_10208165 Ga0207659_102081652 268
78 3300025942 Ga0207689_10029430 Ga0207689_100294303 268
79 3300025944 Ga0207661_10000940 Ga0207661_100009404 268
80 3300025944 Ga0207661_10028363 Ga0207661_100283633 268
81 3300025944 Ga0207661_10197567 Ga0207661_101975671 268
82 3300025945 Ga0207679_10003970 Ga0207679_100039703 268
83 3300025945 Ga0207679_10057678 Ga0207679_100576782 268
84 3300026142 Ga0207698_10002537 Ga0207698_100025374 268
85 3300026142 Ga0207698_10109863 Ga0207698_101098632 268
86 3300037312 Ga0395899_0011397 Ga0395899_0011397_4407_5270 268
87 3300037312 Ga0395899_0238246 Ga0395899_0238246_16_855 268
88 3300037418 Ga0395900_0007443 Ga0395900_0007443_7338_8201 268
89 3300037418 Ga0395900_0040022 Ga0395900_0040022_2640_3479 268
90 3300037466 Ga0395898_0002124 Ga0395898_0002124_2200_3063 268
91 3300038443 Ga0395901_0010128 Ga0395901_0010128_1995_2858 268
92 3300045049 Ga0466959_0086788 Ga0466959_0086788_51_860 268
93 3300005563 Ga0068855_100438757 Ga0068855_1004387572 269
94 3300005614 Ga0068856_100110119 Ga0068856_1001101192 269
95 3300025912 Ga0207707_10001365 Ga0207707_1000136516 269
96 3300025944 Ga0207661_10577258 Ga0207661_105772581 269
97 3300026041 Ga0207639_10016003 Ga0207639_100160032 269
98 3300026142 Ga0207698_10221005 Ga0207698_102210053 269
99 3300049705 Ga0501225_0028394 Ga0501225_0028394_136_957 269
100 iso_pu_bacteria 2896085136 2896087525 269
101 3300005327 Ga0070658_10182503 Ga0070658_101825032 270
102 3300005336 Ga0070680_100064951 Ga0070680_1000649512 270
103 3300005339 Ga0070660_100062307 Ga0070660_1000623072 270
104 3300005366 Ga0070659_100191697 Ga0070659_1001916972 270
105 3300005458 Ga0070681_10357951 Ga0070681_103579512 270
106 3300005563 Ga0068855_100000995 Ga0068855_10000099516 270
107 3300006846 Ga0075430_100002881 Ga0075430_10000288112 270
108 3300006847 Ga0075431_100158712 Ga0075431_1001587122 270
109 3300009551 Ga0105238_10177356 Ga0105238_101773563 270
110 3300009553 Ga0105249_10608423 Ga0105249_106084232 270
111 3300013102 Ga0157371_10000499 Ga0157371_100004999 270
112 3300013104 Ga0157370_10000621 Ga0157370_1000062119 270
113 3300013307 Ga0157372_10088296 Ga0157372_100882963 270
114 3300025917 Ga0207660_10097848 Ga0207660_100978482 270
115 3300025949 Ga0207667_10039915 Ga0207667_100399153 270
116 3300037312 Ga0395899_0006685 Ga0395899_0006685_5632_6447 270
117 3300037466 Ga0395898_0002566 Ga0395898_0002566_15105_15920 270
118 3300038443 Ga0395901_0001075 Ga0395901_0001075_14314_15129 270
119 3300039437 Ga0436365_0174358 Ga0436365_0174358_4862_5758 270
120 3300049570 Ga0501033_0046175 Ga0501033_0046175_2376_3191 270
121 3300049571 Ga0501034_0052389 Ga0501034_0052389_2764_3579 270
122 3300049579 Ga0501043_0247115 Ga0501043_0247115_372_1187 270
123 3300039437 Ga0436365_0274296 Ga0436365_0274296_315_1169 271
124 3300049742 Ga0501080_0370203 Ga0501080_0370203_259_1095 271
125 3300049823 Ga0501044_0094587 Ga0501044_0094587_29_865 271
126 3300013307 Ga0157372_10147462 Ga0157372_101474622 272
127 3300025909 Ga0207705_10092013 Ga0207705_100920132 272
128 3300025949 Ga0207667_10345625 Ga0207667_103456252 273
129 3300005327 Ga0070658_10013653 Ga0070658_100136533 275
130 3300005563 Ga0068855_100006218 Ga0068855_1000062185 275
131 3300013100 Ga0157373_10080959 Ga0157373_100809592 275
132 3300013100 Ga0157373_10130356 Ga0157373_101303561 275
133 3300013105 Ga0157369_10008396 Ga0157369_1000839610 275
134 3300013307 Ga0157372_10015954 Ga0157372_100159545 275
135 3300013307 Ga0157372_10114638 Ga0157372_101146382 275
136 3300025909 Ga0207705_10012213 Ga0207705_100122133 275
137 3300025909 Ga0207705_10168499 Ga0207705_101684993 275
138 3300025912 Ga0207707_10169462 Ga0207707_101694621 275
139 3300025913 Ga0207695_10000060 Ga0207695_1000006067 275
140 3300025917 Ga0207660_10195388 Ga0207660_101953882 275
141 3300025919 Ga0207657_10088811 Ga0207657_100888112 275
142 3300025921 Ga0207652_10000271 Ga0207652_1000027132 275
143 3300025944 Ga0207661_10003161 Ga0207661_100031619 275
144 3300025949 Ga0207667_10000241 Ga0207667_1000024175 275
145 3300025981 Ga0207640_10088126 Ga0207640_100881262 275
146 3300026041 Ga0207639_10503846 Ga0207639_105038461 275
147 3300026078 Ga0207702_10016247 Ga0207702_100162471 275
148 3300037312 Ga0395899_0033078 Ga0395899_0033078_2711_3550 275
149 3300037312 Ga0395899_0050330 Ga0395899_0050330_1902_2741 275
150 3300037418 Ga0395900_0087917 Ga0395900_0087917_249_1088 275
151 3300037418 Ga0395900_0224563 Ga0395900_0224563_265_1104 275
152 3300037466 Ga0395898_0242119 Ga0395898_0242119_793_1632 275
153 3300038443 Ga0395901_0146789 Ga0395901_0146789_316_1155 275
154 3300005336 Ga0070680_100036111 Ga0070680_1000361113 276
155 3300005458 Ga0070681_10066637 Ga0070681_100666373 276
156 3300025917 Ga0207660_10109968 Ga0207660_101099682 276
157 3300005530 Ga0070679_100001499 Ga0070679_1000014999 277
158 3300005616 Ga0068852_100039686 Ga0068852_1000396863 277
159 3300013102 Ga0157371_10019976 Ga0157371_100199766 277
160 3300013307 Ga0157372_10022141 Ga0157372_100221417 277
161 3300025919 Ga0207657_10011956 Ga0207657_100119568 277
162 3300026142 Ga0207698_10002228 Ga0207698_100022285 277
163 2162886012 MBSR1b_contig_5615711 MBSR1b_0172.00007350 278
164 3300005293 Ga0065715_10089266 Ga0065715_100892666 278
165 3300005337 Ga0070682_100048355 Ga0070682_1000483552 278
166 3300005458 Ga0070681_10020423 Ga0070681_100204234 278
167 3300005539 Ga0068853_100070800 Ga0068853_1000708002 278
168 3300005545 Ga0070695_100002409 Ga0070695_1000024095 278
169 3300005563 Ga0068855_100032788 Ga0068855_1000327883 278
170 3300005614 Ga0068856_100418318 Ga0068856_1004183182 278
171 3300009093 Ga0105240_10043740 Ga0105240_100437405 278
172 3300013307 Ga0157372_10020638 Ga0157372_100206384 278
173 3300013307 Ga0157372_10020927 Ga0157372_100209273 278
174 3300025912 Ga0207707_10011491 Ga0207707_100114914 278
175 3300025949 Ga0207667_10057636 Ga0207667_100576363 278
176 3300026041 Ga0207639_10030647 Ga0207639_100306473 278
177 3300026078 Ga0207702_10370475 Ga0207702_103704752 278

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ndx-assembly2.cif.gz_C lysinoalanine cross-linked flge dimer from treponema denticola 0.6972 70 95
5esr-assembly1.cif.gz_A-2 crystal structure of haloalkane dehalogenase (dcca) from caulobacter crescentus 0.6817 72 94
6ndx-assembly1.cif.gz_D lysinoalanine cross-linked flge dimer from treponema denticola 0.6556 73 95
2ygt-assembly1.cif.gz_A clostridium perfringens delta-toxin 0.6487 72 100
6eua-assembly1.cif.gz_C the fibrinogen-like domain of human angptl3 0.6343 72 101
ID Description Score Start End Superfamily
af_A0A0R0HZ72_353_428_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7721 73 93 3.30.420.10
af_A0A0R0JUU4_56_244_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.768 73 97 3.30.420.10
af_Q09392_266_537_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7626 72 94 2.130.10.10
af_Q86WG5_1_168_3.30.450.200 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin module 0.7573 73 95 3.30.450.200
af_A0A1D6MS65_24_322_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7537 73 95 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A512RKD3-F1-model_v4 Uncharacterized protein 0.9789 36 271
AF-A0A1R3WJW0-F1-model_v4 Uncharacterized protein 0.975 26 271
AF-A0A512RKD3-F1-model_v4 Uncharacterized protein 0.9749 36 271
AF-A0A7V3XA52-F1-model_v4 Uncharacterized protein 0.972 20 275
AF-A0A1Y2R9N3-F1-model_v4 Uncharacterized protein 0.9703 30 271

Feature Viewer

pLDDT pTM Quality
88.09 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map