F270154

General Info

Members Datasets Scaffolds Average Seq Length
177 130 354 134

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10087842|Ga0105242_100878422
Length 153
Sequence LRKLDLTAGSGNRSGIFIVMATLKLEIVTPEALTYSEDVDMVTLPSSDGELGIYPNHVPVLTQVVPGEIVVRKGGQDFFLAIGEGFAEITGERVAVLTDMAIKATDIDEVKAEEARRRAEARLQEKLGGEELASVSASLAHSLAQLKVKRRGR

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
36 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
69 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
72 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
73 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
80 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
81 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
111 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
128 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
129 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
130 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 1.13
Rhizosphere 97.18
Stem 0
Stem Tuber 0
Unclassified 19.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10087842 3300009176 Bacteria 2611
2 MBSR1b_contig_335328 2162886012 Bacteria 1654
3 rootH2_10150780 3300003320 Bacteria 1485
4 Ga0068868_100252031 3300005338 Bacteria 1486
5 Ga0070689_100002145 3300005340 Bacteria 12792
6 Ga0070689_100257350 3300005340 Bacteria 1442
7 Ga0070689_100679001 3300005340 Bacteria 898
8 Ga0070661_101661878 3300005344 Unclassified 541
9 Ga0070669_100491857 3300005353 Bacteria 1016
10 Ga0070671_101380462 3300005355 Bacteria 622
11 Ga0070688_100096911 3300005365 Bacteria 1938
12 Ga0070688_100629067 3300005365 Unclassified 824
13 Ga0070688_100937672 3300005365 Unclassified 685
14 Ga0070688_101108739 3300005365 Unclassified 633
15 Ga0070703_10475018 3300005406 Unclassified 558
16 Ga0070678_101852051 3300005456 Bacteria 569
17 Ga0068867_101697117 3300005459 Unclassified 592
18 Ga0070685_10140002 3300005466 Bacteria 1522
19 Ga0070685_10684624 3300005466 Bacteria 746
20 Ga0070707_100653421 3300005468 Bacteria 1014
21 Ga0070707_101655228 3300005468 Unclassified 607
22 Ga0070679_100408806 3300005530 Bacteria 1303
23 Ga0070665_100000030 3300005548 Bacteria 335245
24 Ga0070665_101370991 3300005548 Bacteria 716
25 Ga0070704_101348583 3300005549 Bacteria 653
26 Ga0068857_101799567 3300005577 Bacteria 599
27 Ga0068856_100276002 3300005614 Bacteria 1697
28 Ga0068859_100218587 3300005617 Bacteria 1993
29 Ga0068863_100025313 3300005841 Bacteria 5657
30 Ga0068863_101772606 3300005841 Unclassified 627
31 Ga0068858_100004147 3300005842 Bacteria 14259
32 Ga0081455_10357220 3300005937 Bacteria 1028
33 Ga0070716_100366427 3300006173 Bacteria 1025
34 Ga0097621_100823415 3300006237 Unclassified 861
35 Ga0068871_100718940 3300006358 Bacteria 916
36 Ga0075428_100074357 3300006844 Bacteria 3711
37 Ga0075428_100771301 3300006844 Unclassified 1023
38 Ga0075431_102214932 3300006847 Unclassified 504
39 Ga0075433_10358103 3300006852 Bacteria 1289
40 Ga0075434_100548387 3300006871 Bacteria 1176
41 Ga0075434_100548412 3300006871 Bacteria 1176
42 Ga0075434_101946920 3300006871 Unclassified 593
43 Ga0075429_100329908 3300006880 Unclassified 1335
44 Ga0075429_100599665 3300006880 Unclassified 965
45 Ga0068865_101247778 3300006881 Unclassified 659
46 Ga0097620_100218587 3300006931 Bacteria 1993
47 Ga0075435_100362319 3300007076 Bacteria 1244
48 Ga0099795_10313067 3300007788 Bacteria 693
49 Ga0105251_10591748 3300009011 Unclassified 526
50 Ga0105240_10060583 3300009093 Bacteria 4718
51 Ga0111539_10201491 3300009094 Bacteria 2321
52 Ga0111539_10714733 3300009094 Bacteria 1166
53 Ga0105247_10048393 3300009101 Bacteria 2611
54 Ga0105248_10273267 3300009177 Bacteria 1903
55 Ga0105248_10408751 3300009177 Bacteria 1528
56 Ga0105238_11065490 3300009551 Bacteria 830
57 Ga0105239_11335408 3300010375 Bacteria 827
58 Ga0105246_11783347 3300011119 Bacteria 587
59 Ga0157370_10798597 3300013104 Bacteria 859
60 Ga0157369_10513022 3300013105 Bacteria 1240
61 Ga0157374_10018822 3300013296 Bacteria 6103
62 Ga0157374_10130111 3300013296 Bacteria 2436
63 Ga0157372_10309965 3300013307 Bacteria 1837
64 Ga0157375_10441931 3300013308 Bacteria 1466
65 Ga0163163_10000049 3300014325 Bacteria 130036
66 Ga0157377_11112942 3300014745 Unclassified 606
67 Ga0157376_10334744 3300014969 Bacteria 1443
68 Ga0157376_11062384 3300014969 Bacteria 834
69 Ga0207653_10353379 3300025885 Unclassified 574
70 Ga0207710_10176488 3300025900 Bacteria 1046
71 Ga0207699_10264651 3300025906 Bacteria 1189
72 Ga0207695_10083132 3300025913 Bacteria 3234
73 Ga0207671_10179704 3300025914 Bacteria 1646
74 Ga0207649_10421972 3300025920 Bacteria 1002
75 Ga0207686_10285759 3300025934 Bacteria 1219
76 Ga0207670_10002385 3300025936 Bacteria 9837
77 Ga0207670_10179516 3300025936 Bacteria 1594
78 Ga0207670_10517777 3300025936 Bacteria 971
79 Ga0207704_11651028 3300025938 Unclassified 551
80 Ga0207665_10172107 3300025939 Bacteria 1564
81 Ga0207711_10233311 3300025941 Bacteria 1686
82 Ga0207711_10361373 3300025941 Bacteria 1345
83 Ga0207712_11144075 3300025961 Bacteria 693
84 Ga0207703_10017821 3300026035 Bacteria 5546
85 Ga0207702_10193476 3300026078 Bacteria 1881
86 Ga0207641_10013532 3300026088 Bacteria 6692
87 Ga0268266_10000031 3300028379 Bacteria 406292
88 Ga0268266_11092616 3300028379 Bacteria 772
89 Ga0268266_11661793 3300028379 Unclassified 614
90 Ga0265337_1030398 3300028556 Bacteria 1609
91 Ga0265326_10008166 3300028558 Bacteria 3167
92 Ga0265338_10000032 3300028800 Bacteria 257580
93 Ga0265338_10004439 3300028800 Bacteria 18945
94 Ga0265324_10004282 3300029957 Bacteria 6512
95 Ga0265324_10010278 3300029957 Bacteria 3617
96 Ga0307511_10009242 3300030521 Bacteria 9821
97 Ga0265339_10034717 3300031249 Bacteria 2833
98 Ga0265339_10053867 3300031249 Bacteria 2187
99 Ga0265327_10023405 3300031251 Bacteria 3659
100 Ga0307412_11307018 3300031911 Unclassified 653
101 Ga0307409_101755010 3300031995 Bacteria 650
102 Ga0307416_100619704 3300032002 Bacteria 1164
103 Ga0307414_11389385 3300032004 Unclassified 652
104 Ga0373934_0150785 3300035086 Bacteria 952
105 Ga0373945_0569634 3300035116 Bacteria 510
106 Ga0373957_0077866 3300035120 Bacteria 1305
107 Ga0373943_0656310 3300035170 Viruses 620
108 Ga0373955_0463972 3300035172 Bacteria 772
109 Ga0373924_0083884 3300035410 Bacteria 1358
110 Ga0373931_0566140 3300035691 Bacteria 740
111 Ga0373947_0461902 3300035725 Unclassified 860
112 Ga0373937_0019395 3300036401 Bacteria 6087
113 Ga0373937_0106762 3300036401 Bacteria 2603
114 Ga0373937_0674475 3300036401 Unclassified 980
115 Ga0373925_0246480 3300037068 Bacteria 1432
116 Ga0395900_0741256 3300037418 Bacteria 913
117 Ga0395905_0243223 3300037471 Bacteria 1681
118 Ga0451577_0001005 3300042876 Bacteria 41060
119 Ga0451577_0009986 3300042876 Bacteria 9097
120 Ga0451577_0033413 3300042876 Bacteria 4637
121 Ga0453684_0002436 3300044712 Bacteria 45223
122 Ga0453684_0012378 3300044712 Bacteria 14083
123 Ga0451576_0099515 3300045051 Bacteria 3025
124 Ga0451576_0525998 3300045051 Bacteria 1242
125 Ga0451576_1553121 3300045051 Bacteria 687
126 Ga0495651_0156192 3300046462 Viruses 1639
127 Ga0495662_0106295 3300046476 Bacteria 1374
128 Ga0495664_0257964 3300046477 Bacteria 1054
129 Ga0495618_0109258 3300046514 Bacteria 1771
130 Ga0495618_0325686 3300046514 Bacteria 951
131 Ga0495628_0649057 3300046516 Bacteria 749
132 Ga0495630_0000119 3300046517 Bacteria 62254
133 Ga0495630_0853114 3300046517 Bacteria 694
134 Ga0495666_0007307 3300046526 Bacteria 5543
135 Ga0495640_0359002 3300046533 Bacteria 898
136 Ga0495640_0372977 3300046533 Bacteria 879
137 Ga0495586_0006266 3300046535 Bacteria 6356
138 Ga0495645_0050131 3300046543 Bacteria 3040
139 Ga0495622_0006561 3300046557 Bacteria 5397
140 Ga0495622_0428811 3300046557 Unclassified 568
141 Ga0495634_0010402 3300046642 Bacteria 6817
142 Ga0495635_0502849 3300046663 Unclassified 798
143 Ga0495658_0079991 3300046683 Unclassified 1916
144 Ga0495613_0006445 3300046689 Bacteria 8775
145 Ga0495613_0059743 3300046689 Bacteria 2794
146 Ga0495613_0094930 3300046689 Bacteria 2158
147 Ga0495624_0788320 3300046690 Unclassified 562
148 Ga0495600_0814696 3300046809 Viruses 555
149 Ga0495581_0016845 3300047315 Bacteria 4248
150 Ga0495674_0040525 3300047319 Bacteria 4166
151 Ga0495676_0000717 3300047321 Bacteria 27596
152 Ga0495676_0600833 3300047321 Bacteria 716
153 Ga0495680_0701778 3300047322 Bacteria 668
154 Ga0495684_0322120 3300047471 Bacteria 1105
155 Ga0495615_0182455 3300048090 Unclassified 640
156 Ga0496102_0876016 3300048905 Unclassified 820
157 Ga0496112_0396325 3300048915 Unclassified 1320
158 Ga0501080_0323285 3300049742 Bacteria 1396
159 Ga0501035_0096266 3300049822 Bacteria 2601
160 nmdc:mga09592_119950_c1 3300050508 Bacteria 2258
161 nmdc:mga09592_195287_c1 3300050508 Bacteria 1752
162 nmdc:mga0qj67_277578_c1 3300050509 Bacteria 1358
163 nmdc:mga0qj67_695067_c1 3300050509 Bacteria 809
164 nmdc:mga06r32_246468_c1 3300050510 Bacteria 1774
165 nmdc:mga06r32_425965_c1 3300050510 Bacteria 1308
166 nmdc:mga06r32_459879_c1 3300050510 Bacteria 1252
167 nmdc:mga08y16_214064_c1 3300050511 Bacteria 1995
168 nmdc:mga08y16_227315_c1 3300050511 Unclassified 1930
169 nmdc:mga08y16_321538_c1 3300050511 Bacteria 1593
170 nmdc:mga0n895_1529897_c1 3300050512 Unclassified 633
171 nmdc:mga0n895_90909_c1 3300050512 Bacteria 3054
172 nmdc:mga0n895_92151_c1 3300050512 Bacteria 3033
173 nmdc:mga0rr50_723952_c1 3300050513 Unclassified 849
174 nmdc:mga0a205_363860_c1 3300050515 Bacteria 1313
175 Ga0495601_0122472 3300053077 Viruses 1690
176 Ga0500635_0237453 3300053080 Bacteria 713
177 Ga0495595_0739457 3300053084 Viruses 505
178 Ga0105242_10087842
179 MBSR1b_contig_335328
180 rootH2_10150780
181 Ga0068868_100252031
182 Ga0070689_100002145
183 Ga0070689_100257350
184 Ga0070689_100679001
185 Ga0070661_101661878
186 Ga0070669_100491857
187 Ga0070671_101380462
188 Ga0070688_100096911
189 Ga0070688_100629067
190 Ga0070688_100937672
191 Ga0070688_101108739
192 Ga0070703_10475018
193 Ga0070678_101852051
194 Ga0068867_101697117
195 Ga0070685_10140002
196 Ga0070685_10684624
197 Ga0070707_100653421
198 Ga0070707_101655228
199 Ga0070679_100408806
200 Ga0070665_100000030
201 Ga0070665_101370991
202 Ga0070704_101348583
203 Ga0068857_101799567
204 Ga0068856_100276002
205 Ga0068859_100218587
206 Ga0068863_100025313
207 Ga0068863_101772606
208 Ga0068858_100004147
209 Ga0081455_10357220
210 Ga0070716_100366427
211 Ga0097621_100823415
212 Ga0068871_100718940
213 Ga0075428_100074357
214 Ga0075428_100771301
215 Ga0075431_102214932
216 Ga0075433_10358103
217 Ga0075434_100548387
218 Ga0075434_100548412
219 Ga0075434_101946920
220 Ga0075429_100329908
221 Ga0075429_100599665
222 Ga0068865_101247778
223 Ga0097620_100218587
224 Ga0075435_100362319
225 Ga0099795_10313067
226 Ga0105251_10591748
227 Ga0105240_10060583
228 Ga0111539_10201491
229 Ga0111539_10714733
230 Ga0105247_10048393
231 Ga0105248_10273267
232 Ga0105248_10408751
233 Ga0105238_11065490
234 Ga0105239_11335408
235 Ga0105246_11783347
236 Ga0157370_10798597
237 Ga0157369_10513022
238 Ga0157374_10018822
239 Ga0157374_10130111
240 Ga0157372_10309965
241 Ga0157375_10441931
242 Ga0163163_10000049
243 Ga0157377_11112942
244 Ga0157376_10334744
245 Ga0157376_11062384
246 Ga0207653_10353379
247 Ga0207710_10176488
248 Ga0207699_10264651
249 Ga0207695_10083132
250 Ga0207671_10179704
251 Ga0207649_10421972
252 Ga0207686_10285759
253 Ga0207670_10002385
254 Ga0207670_10179516
255 Ga0207670_10517777
256 Ga0207704_11651028
257 Ga0207665_10172107
258 Ga0207711_10233311
259 Ga0207711_10361373
260 Ga0207712_11144075
261 Ga0207703_10017821
262 Ga0207702_10193476
263 Ga0207641_10013532
264 Ga0268266_10000031
265 Ga0268266_11092616
266 Ga0268266_11661793
267 Ga0265337_1030398
268 Ga0265326_10008166
269 Ga0265338_10000032
270 Ga0265338_10004439
271 Ga0265324_10004282
272 Ga0265324_10010278
273 Ga0307511_10009242
274 Ga0265339_10034717
275 Ga0265339_10053867
276 Ga0265327_10023405
277 Ga0307412_11307018
278 Ga0307409_101755010
279 Ga0307416_100619704
280 Ga0307414_11389385
281 Ga0373934_0150785
282 Ga0373945_0569634
283 Ga0373957_0077866
284 Ga0373943_0656310
285 Ga0373955_0463972
286 Ga0373924_0083884
287 Ga0373931_0566140
288 Ga0373947_0461902
289 Ga0373937_0019395
290 Ga0373937_0106762
291 Ga0373937_0674475
292 Ga0373925_0246480
293 Ga0395900_0741256
294 Ga0395905_0243223
295 Ga0451577_0001005
296 Ga0451577_0009986
297 Ga0451577_0033413
298 Ga0453684_0002436
299 Ga0453684_0012378
300 Ga0451576_0099515
301 Ga0451576_0525998
302 Ga0451576_1553121
303 Ga0495651_0156192
304 Ga0495662_0106295
305 Ga0495664_0257964
306 Ga0495618_0109258
307 Ga0495618_0325686
308 Ga0495628_0649057
309 Ga0495630_0000119
310 Ga0495630_0853114
311 Ga0495666_0007307
312 Ga0495640_0359002
313 Ga0495640_0372977
314 Ga0495586_0006266
315 Ga0495645_0050131
316 Ga0495622_0006561
317 Ga0495622_0428811
318 Ga0495634_0010402
319 Ga0495635_0502849
320 Ga0495658_0079991
321 Ga0495613_0006445
322 Ga0495613_0059743
323 Ga0495613_0094930
324 Ga0495624_0788320
325 Ga0495600_0814696
326 Ga0495581_0016845
327 Ga0495674_0040525
328 Ga0495676_0000717
329 Ga0495676_0600833
330 Ga0495680_0701778
331 Ga0495684_0322120
332 Ga0495615_0182455
333 Ga0496102_0876016
334 Ga0496112_0396325
335 Ga0501080_0323285
336 Ga0501035_0096266
337 nmdc:mga09592_119950_c1
338 nmdc:mga09592_195287_c1
339 nmdc:mga0qj67_277578_c1
340 nmdc:mga0qj67_695067_c1
341 nmdc:mga06r32_246468_c1
342 nmdc:mga06r32_425965_c1
343 nmdc:mga06r32_459879_c1
344 nmdc:mga08y16_214064_c1
345 nmdc:mga08y16_227315_c1
346 nmdc:mga08y16_321538_c1
347 nmdc:mga0n895_1529897_c1
348 nmdc:mga0n895_90909_c1
349 nmdc:mga0n895_92151_c1
350 nmdc:mga0rr50_723952_c1
351 nmdc:mga0a205_363860_c1
352 Ga0495601_0122472
353 Ga0500635_0237453
354 Ga0495595_0739457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

23

101

0.98

PF00401

ATP-synt_DE

ATP synthase, Delta/Epsilon chain, long alpha-helix domain

105

150

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dn6-assembly1.cif.gz_I atp synthase from paracoccus denitrificans 0.9378 9 79
7nk9-assembly1.cif.gz_H mycobacterium smegmatis atp synthase fo domain state 1 0.9209 20 77
7nl9-assembly1.cif.gz_H mycobacterium smegmatis atp synthase fo state 3 0.9003 4 77
3oee-assembly1.cif.gz_H structure of four mutant forms of yeast f1 atpase: alpha-f405s 0.8955 6 82
7tkk-assembly1.cif.gz_H yeast atp synthase state 2catalytic(e) with 10 mm atp backbone model 0.8852 6 82
ID Description Score Start End Superfamily
af_Q2FWF1_1_89_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9758 1 87 2.60.15.10
2e5yB01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9707 1 87 2.60.15.10
af_P00835_1_88_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9591 3 86 2.60.15.10
af_A0A0R0KXY9_13_77_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9572 25 86 2.60.15.10
2e5yB01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9494 1 87 2.60.15.10
ID Description Score Start End GO Terms
AF-A0A7W0NUT7-F1-model_v4 ATP synthase F1 subunit epsilon 0.9924 4 80 GO:0012505
GO:0045261
GO:0046933
AF-A6LJR0-F1-model_v4 H+-transporting two-sector ATPase, delta/epsilon subunit 0.9913 2 83 GO:0012505
GO:0045261
GO:0046933
AF-A0A251V6S5-F1-model_v4 H(+)-transporting two-sector ATPase (Putative ATPase, F1 complex, delta/epsilon subunit) 0.9898 3 86 GO:0015986
GO:0045261
GO:0046933
AF-A0A3L7VL46-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.989 2 84 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-A0A7C7L6X6-F1-model_v4 ATP synthase F1 complex delta/epsilon subunit N-terminal domain-containing protein 0.9888 3 84 GO:0012505
GO:0045261
GO:0046933

Map