F270110

General Info

Members Datasets Scaffolds Average Seq Length
177 136 354 332

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10465577|Ga0111539_104655772
Length 306
Sequence VNAAQPQAVLSPLTEAAIFLVLTVDVGRENAVRTLLEDASGLRRSVGFRIPEGELSCVVGLGSGLWDRLFGAPRPAGLHAFAALDGSTHTAVATPGDLLFHIRAHRFDLCFELAQRLTDRLRGHAQVIDEVHGFRSFDERDLLGFVDGTENPEGVSAAGEEDAAFAGGSYVVVQKYLHDLQAWDALPVAEQERAIGRQKLSDVEIPDEEKAANAHVALNTITDADGEERQIVRLNMPFGKVGDAEFGTYFIGYARTPEVIEEMLRNMFIGKPPGTYDRILDFSTAVTGSLFFVPSLDLLDDPPGTD

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
13 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
14 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
17 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
20 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
29 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
30 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
31 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
32 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
33 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
34 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
35 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
36 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
37 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
38 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
39 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
40 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
41 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
42 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
43 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
44 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
45 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
46 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
47 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
48 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
49 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
50 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
51 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
52 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
53 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
54 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
55 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
56 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
57 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
58 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
59 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
60 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
61 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
62 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
63 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
64 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
65 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
66 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
67 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
68 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
69 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
70 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
71 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
72 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
73 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
74 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
75 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
76 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
77 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
78 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
79 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
80 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
81 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
82 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
83 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
84 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
87 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
88 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
89 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
90 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
91 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
92 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
93 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
94 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
97 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
98 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
99 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
100 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
101 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
102 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
103 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
106 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
107 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
121 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
122 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
123 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
124 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
125 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
126 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
127 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
128 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
129 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
130 2643221617 Nocardioides sp. Root79 Isolate Unclassified
131 2643221620 Nocardioides sp. Root240 Isolate Unclassified
132 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
133 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
134 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
135 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
136 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.92
Metatranscriptomes 0
Isolates 5.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.34
Nodule 0
Rhizoplane 4.52
Rhizosphere 74.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10465577 3300009094 Bacteria 1472
2 Ga0055540_1000071 3300003792 Bacteria 117607
3 Ga0055540_1005212 3300003792 Bacteria 5559
4 Ga0070714_100000222 3300005435 Bacteria 45199
5 Ga0070714_100013759 3300005435 Bacteria 6488
6 Ga0070714_100036010 3300005435 Bacteria 4149
7 Ga0070714_100136742 3300005435 Bacteria 2195
8 Ga0070714_100197509 3300005435 Bacteria 1839
9 Ga0070714_100311369 3300005435 Bacteria 1470
10 Ga0070713_100162173 3300005436 Bacteria 1996
11 Ga0070710_10222239 3300005437 Bacteria 1202
12 Ga0070711_100066350 3300005439 Bacteria 2527
13 Ga0070706_100043523 3300005467 Bacteria 4149
14 Ga0070707_100000692 3300005468 Bacteria 33481
15 Ga0070698_100178100 3300005471 Bacteria 2065
16 Ga0081455_10060045 3300005937 Bacteria 3207
17 Ga0081455_10081074 3300005937 Bacteria 2658
18 Ga0081538_10000245 3300005981 Bacteria 61398
19 Ga0081538_10001449 3300005981 Bacteria 24381
20 Ga0070717_10014516 3300006028 Bacteria 6062
21 Ga0070717_10022336 3300006028 Bacteria 4998
22 Ga0070717_10068141 3300006028 Bacteria 2962
23 Ga0070717_10077293 3300006028 Bacteria 2787
24 Ga0070717_10121157 3300006028 Bacteria 2241
25 Ga0070715_10088129 3300006163 Bacteria 1422
26 Ga0070712_100135568 3300006175 Bacteria 1871
27 Ga0075431_100084047 3300006847 Bacteria 3286
28 Ga0075434_100449134 3300006871 Bacteria 1310
29 Ga0075434_100535057 3300006871 Bacteria 1192
30 Ga0111539_10052359 3300009094 Bacteria 4859
31 Ga0111539_10279805 3300009094 Bacteria 1941
32 Ga0105245_10405300 3300009098 Bacteria 1364
33 Ga0114129_10034296 3300009147 Bacteria 7167
34 Ga0114129_10379980 3300009147 Bacteria 1866
35 Ga0157372_10052911 3300013307 Bacteria 4523
36 Ga0209051_1000033 3300025303 Bacteria 380540
37 Ga0209051_1001165 3300025303 Bacteria 23878
38 Ga0209051_1003835 3300025303 Bacteria 9628
39 Ga0207684_10004504 3300025910 Bacteria 13099
40 Ga0207693_10075616 3300025915 Bacteria 2637
41 Ga0207693_10133756 3300025915 Bacteria 1949
42 Ga0207646_10004586 3300025922 Bacteria 14950
43 Ga0207700_10096210 3300025928 Bacteria 2350
44 Ga0207664_10001800 3300025929 Bacteria 14133
45 Ga0207664_10015880 3300025929 Bacteria 5482
46 Ga0207664_10020164 3300025929 Bacteria 4936
47 Ga0207664_10021884 3300025929 Bacteria 4764
48 Ga0207664_10024580 3300025929 Bacteria 4529
49 Ga0207664_10178689 3300025929 Bacteria 1821
50 Ga0207709_10035361 3300025935 Bacteria 2953
51 Ga0207678_10025726 3300026067 Bacteria 5136
52 Ga0265340_10000166 3300031247 Bacteria 33210
53 Ga0265327_10002081 3300031251 Bacteria 22359
54 Ga0307413_10058580 3300031824 Bacteria 2362
55 Ga0307407_10013206 3300031903 Bacteria 3999
56 Ga0307412_10136543 3300031911 Bacteria 1790
57 Ga0307409_100130254 3300031995 Bacteria 2148
58 Ga0307409_100157500 3300031995 Bacteria 1981
59 Ga0307507_10000011 3300033179 Bacteria 261849
60 Ga0373927_0055205 3300035695 Bacteria 2569
61 Ga0395899_0008116 3300037312 Bacteria 8089
62 Ga0395900_0031274 3300037418 Bacteria 5467
63 Ga0395898_0005769 3300037466 Bacteria 13325
64 Ga0395905_0004105 3300037471 Bacteria 15256
65 Ga0436364_0365971 3300037853 Bacteria 84277
66 Ga0436364_1543550 3300037853 Bacteria 3867
67 Ga0395901_0031913 3300038443 Bacteria 5432
68 Ga0395901_0242599 3300038443 Bacteria 1879
69 Ga0436365_1733483 3300039437 Bacteria 6204
70 Ga0436363_1112055 3300039450 Bacteria 2175
71 Ga0436363_1500094 3300039450 Bacteria 1745
72 Ga0436362_0132190 3300039453 Bacteria 2603
73 Ga0436362_0184764 3300039453 Bacteria 1389
74 Ga0451789_0055818 3300041443 Bacteria 1173
75 Ga0451793_0987355 3300041452 Bacteria 2348
76 Ga0439448_0006033 3300042005 Bacteria 3471
77 Ga0466969_0061168 3300044656 Bacteria 1830
78 Ga0466965_0016880 3300044683 Bacteria 3482
79 Ga0466967_0043114 3300045976 Bacteria 3905
80 Ga0466967_0149958 3300045976 Bacteria 2178
81 Ga0495603_0006457 3300046455 Bacteria 7022
82 Ga0495629_0026509 3300046459 Bacteria 4116
83 Ga0495651_0032739 3300046462 Bacteria 4053
84 Ga0495605_0000611 3300046474 Bacteria 27920
85 Ga0495662_0117744 3300046476 Bacteria 1303
86 Ga0495664_0002028 3300046477 Bacteria 10818
87 Ga0495594_0073196 3300046499 Bacteria 1906
88 Ga0495607_0074529 3300046501 Bacteria 1883
89 Ga0495583_0058978 3300046506 Bacteria 1721
90 Ga0495606_0027635 3300046507 Bacteria 4018
91 Ga0495610_0095909 3300046512 Bacteria 1336
92 Ga0495616_0003674 3300046513 Bacteria 9799
93 Ga0495620_0003202 3300046515 Bacteria 9397
94 Ga0495630_0220198 3300046517 Bacteria 1449
95 Ga0495631_0020980 3300046518 Bacteria 3045
96 Ga0495648_0054671 3300046524 Bacteria 2411
97 Ga0495666_0012883 3300046526 Bacteria 4167
98 Ga0495640_0152039 3300046533 Bacteria 1487
99 Ga0495587_0047830 3300046536 Bacteria 2535
100 Ga0495597_0031206 3300046542 Bacteria 2426
101 Ga0495668_0006528 3300046616 Bacteria 7625
102 Ga0495634_0001107 3300046642 Bacteria 24966
103 Ga0495611_0022575 3300046648 Bacteria 2723
104 Ga0495625_0062224 3300046660 Bacteria 2638
105 Ga0495635_0009541 3300046663 Bacteria 6782
106 Ga0495635_0048413 3300046663 Bacteria 2930
107 Ga0495635_0261841 3300046663 Bacteria 1164
108 Ga0495657_0020412 3300046675 Bacteria 4761
109 Ga0495599_0101540 3300046678 Bacteria 1793
110 Ga0495623_0055975 3300046679 Bacteria 2484
111 Ga0495646_0024327 3300046680 Bacteria 3814
112 Ga0495624_0110864 3300046690 Bacteria 1687
113 Ga0495649_0139370 3300046694 Bacteria 1277
114 Ga0495600_0020242 3300046809 Bacteria 4255
115 Ga0495604_0000302 3300047317 Bacteria 44207
116 Ga0495604_0070089 3300047317 Bacteria 2656
117 Ga0495604_0076728 3300047317 Bacteria 2513
118 Ga0495676_0046573 3300047321 Bacteria 3517
119 Ga0495680_0090646 3300047322 Bacteria 2293
120 Ga0495680_0105246 3300047322 Bacteria 2098
121 Ga0495675_0101115 3300047444 Bacteria 1804
122 Ga0495681_0053847 3300047470 Bacteria 1882
123 Ga0495686_0067159 3300047472 Bacteria 2214
124 Ga0495593_0009175 3300047673 Bacteria 5733
125 Ga0495614_0022790 3300048089 Bacteria 2700
126 Ga0496100_0125131 3300048903 Bacteria 1803
127 Ga0496101_0045042 3300048904 Bacteria 3158
128 Ga0496106_0051333 3300048909 Bacteria 3109
129 Ga0496107_0015687 3300048910 Bacteria 5311
130 Ga0496109_0040017 3300048912 Bacteria 4245
131 Ga0496115_0116516 3300048918 Bacteria 2197
132 Ga0496116_0000014 3300048919 Bacteria 569049
133 Ga0496117_0060897 3300048920 Bacteria 2598
134 Ga0496119_0000862 3300048922 Bacteria 40026
135 Ga0496119_0029761 3300048922 Bacteria 3693
136 Ga0496120_0001827 3300048923 Bacteria 23773
137 Ga0496121_0004685 3300048924 Bacteria 18134
138 Ga0496124_0002116 3300048927 Bacteria 26731
139 Ga0496125_0145334 3300048928 Bacteria 1640
140 Ga0496126_0000379 3300048929 Bacteria 92123
141 Ga0496126_0161514 3300048929 Bacteria 1914
142 Ga0496126_0261874 3300048929 Bacteria 1438
143 Ga0495678_053728 3300049459 Bacteria 1545
144 Ga0495682_0099270 3300049460 Bacteria 1044
145 Ga0501042_0001768 3300049578 Bacteria 12927
146 Ga0501047_0037868 3300049581 Bacteria 4665
147 Ga0501069_0021080 3300049585 Bacteria 3534
148 Ga0501071_0012251 3300049587 Bacteria 5808
149 Ga0501074_0040710 3300049590 Bacteria 3364
150 Ga0501079_0012769 3300049741 Bacteria 6416
151 Ga0501083_0008708 3300049744 Bacteria 7157
152 nmdc:mga05p37_435361_c1 3300050507 Bacteria 1522
153 nmdc:mga06r32_144546_c1 3300050510 Bacteria 2356
154 nmdc:mga06r32_332205_c1 3300050510 Bacteria 1505
155 nmdc:mga08y16_286840_c1 3300050511 Bacteria 1697
156 nmdc:mga0n895_159218_c1 3300050512 Bacteria 2289
157 nmdc:mga0rr50_56694_c1 3300050513 Bacteria 2928
158 nmdc:mga0a205_358663_c1 3300050515 Bacteria 1324
159 Ga0495601_0219107 3300053077 Bacteria 1243
160 Ga0495619_0025232 3300053085 Bacteria 3816
161 Ga0500556_0003318 3300053104 Bacteria 4763
162 Ga0500595_026174 3300053119 Bacteria 2013
163 Ga0500568_0063040 3300053139 Bacteria 1431
164 Ga0500616_0000672 3300053153 Bacteria 40160
165 Ga0500616_0028861 3300053153 Bacteria 3055
166 Ga0500616_0049920 3300053153 Bacteria 2211
167 Ga0500624_003154 3300053157 Bacteria 2175
168 Ga0500599_007064 3300053736 Bacteria 1440
169 2616701032 2616644814 Bacteria 11555299
170 2643946016 2643221587 Bacteria 7586415
171 2644102928 2643221617 Bacteria 5139111
172 2644118586 2643221620 Bacteria 5134593
173 2644432805 2643221677 Bacteria 7584031
174 2644491264 2643221687 Bacteria 6500351
175 2812334308 2811994874 Bacteria 5367947
176 2870790313 2870782633 Bacteria 9624083
177 2902842954 2902837492 Bacteria 6697721
178 Ga0111539_10465577
179 Ga0055540_1000071
180 Ga0055540_1005212
181 Ga0070714_100000222
182 Ga0070714_100013759
183 Ga0070714_100036010
184 Ga0070714_100136742
185 Ga0070714_100197509
186 Ga0070714_100311369
187 Ga0070713_100162173
188 Ga0070710_10222239
189 Ga0070711_100066350
190 Ga0070706_100043523
191 Ga0070707_100000692
192 Ga0070698_100178100
193 Ga0081455_10060045
194 Ga0081455_10081074
195 Ga0081538_10000245
196 Ga0081538_10001449
197 Ga0070717_10014516
198 Ga0070717_10022336
199 Ga0070717_10068141
200 Ga0070717_10077293
201 Ga0070717_10121157
202 Ga0070715_10088129
203 Ga0070712_100135568
204 Ga0075431_100084047
205 Ga0075434_100449134
206 Ga0075434_100535057
207 Ga0111539_10052359
208 Ga0111539_10279805
209 Ga0105245_10405300
210 Ga0114129_10034296
211 Ga0114129_10379980
212 Ga0157372_10052911
213 Ga0209051_1000033
214 Ga0209051_1001165
215 Ga0209051_1003835
216 Ga0207684_10004504
217 Ga0207693_10075616
218 Ga0207693_10133756
219 Ga0207646_10004586
220 Ga0207700_10096210
221 Ga0207664_10001800
222 Ga0207664_10015880
223 Ga0207664_10020164
224 Ga0207664_10021884
225 Ga0207664_10024580
226 Ga0207664_10178689
227 Ga0207709_10035361
228 Ga0207678_10025726
229 Ga0265340_10000166
230 Ga0265327_10002081
231 Ga0307413_10058580
232 Ga0307407_10013206
233 Ga0307412_10136543
234 Ga0307409_100130254
235 Ga0307409_100157500
236 Ga0307507_10000011
237 Ga0373927_0055205
238 Ga0395899_0008116
239 Ga0395900_0031274
240 Ga0395898_0005769
241 Ga0395905_0004105
242 Ga0436364_0365971
243 Ga0436364_1543550
244 Ga0395901_0031913
245 Ga0395901_0242599
246 Ga0436365_1733483
247 Ga0436363_1112055
248 Ga0436363_1500094
249 Ga0436362_0132190
250 Ga0436362_0184764
251 Ga0451789_0055818
252 Ga0451793_0987355
253 Ga0439448_0006033
254 Ga0466969_0061168
255 Ga0466965_0016880
256 Ga0466967_0043114
257 Ga0466967_0149958
258 Ga0495603_0006457
259 Ga0495629_0026509
260 Ga0495651_0032739
261 Ga0495605_0000611
262 Ga0495662_0117744
263 Ga0495664_0002028
264 Ga0495594_0073196
265 Ga0495607_0074529
266 Ga0495583_0058978
267 Ga0495606_0027635
268 Ga0495610_0095909
269 Ga0495616_0003674
270 Ga0495620_0003202
271 Ga0495630_0220198
272 Ga0495631_0020980
273 Ga0495648_0054671
274 Ga0495666_0012883
275 Ga0495640_0152039
276 Ga0495587_0047830
277 Ga0495597_0031206
278 Ga0495668_0006528
279 Ga0495634_0001107
280 Ga0495611_0022575
281 Ga0495625_0062224
282 Ga0495635_0009541
283 Ga0495635_0048413
284 Ga0495635_0261841
285 Ga0495657_0020412
286 Ga0495599_0101540
287 Ga0495623_0055975
288 Ga0495646_0024327
289 Ga0495624_0110864
290 Ga0495649_0139370
291 Ga0495600_0020242
292 Ga0495604_0000302
293 Ga0495604_0070089
294 Ga0495604_0076728
295 Ga0495676_0046573
296 Ga0495680_0090646
297 Ga0495680_0105246
298 Ga0495675_0101115
299 Ga0495681_0053847
300 Ga0495686_0067159
301 Ga0495593_0009175
302 Ga0495614_0022790
303 Ga0496100_0125131
304 Ga0496101_0045042
305 Ga0496106_0051333
306 Ga0496107_0015687
307 Ga0496109_0040017
308 Ga0496115_0116516
309 Ga0496116_0000014
310 Ga0496117_0060897
311 Ga0496119_0000862
312 Ga0496119_0029761
313 Ga0496120_0001827
314 Ga0496121_0004685
315 Ga0496124_0002116
316 Ga0496125_0145334
317 Ga0496126_0000379
318 Ga0496126_0161514
319 Ga0496126_0261874
320 Ga0495678_053728
321 Ga0495682_0099270
322 Ga0501042_0001768
323 Ga0501047_0037868
324 Ga0501069_0021080
325 Ga0501071_0012251
326 Ga0501074_0040710
327 Ga0501079_0012769
328 Ga0501083_0008708
329 nmdc:mga05p37_435361_c1
330 nmdc:mga06r32_144546_c1
331 nmdc:mga06r32_332205_c1
332 nmdc:mga08y16_286840_c1
333 nmdc:mga0n895_159218_c1
334 nmdc:mga0rr50_56694_c1
335 nmdc:mga0a205_358663_c1
336 Ga0495601_0219107
337 Ga0495619_0025232
338 Ga0500556_0003318
339 Ga0500595_026174
340 Ga0500568_0063040
341 Ga0500616_0000672
342 Ga0500616_0028861
343 Ga0500616_0049920
344 Ga0500624_003154
345 Ga0500599_007064
346 2616701032
347 2643946016
348 2644102928
349 2644118586
350 2644432805
351 2644491264
352 2812334308
353 2870790313
354 2902842954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04261

Dyp_perox_N

Dyp-type peroxidase, N-terminal

6

135

0.97

PF20628

Dyp_perox_C

Dyp-type peroxidase, C-terminal

138

298

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qzf-assembly1.cif.gz_C sfx structure of dye-type peroxidase dtpb d152a/n245a variant in the ferric state 0.9744 3 305
7bok-assembly1.cif.gz_A cryo-em structure of the encapsulated dyp-type peroxidase from mycobacterium smegmatis 0.9736 3 309
6yr4-assembly1.cif.gz_C dye-type peroxidase dtpb in the ferryl state: spectroscopically validated composite structure 0.9733 3 305
7zmj-assembly1.cif.gz_A sfx structure of dye-type peroxidase dtpb r243a variant in the ferric state 0.9732 3 305
7qzg-assembly1.cif.gz_D sfx structure of dye-type peroxidase dtpb n245a variant in the ferric state 0.972 5 305
ID Description Score Start End Superfamily
af_Q22498_753_870_3.30.310.10 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein 0.6674 227 269 3.30.310.10
af_Q8IHR6_950_1067_3.30.310.10 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein 0.6447 236 272 3.30.310.10
af_P9WL45_12_126_3.30.70.1030 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.6444 12 133 3.30.70.1030
4im8A02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6438 230 261 2.60.40.10
af_P9WL45_128_230_3.30.70.1030 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.6417 16 133 3.30.70.1030
ID Description Score Start End GO Terms
AF-A0A373DWE7-F1-model_v4 Dyp-type peroxidase C-terminal domain-containing protein 0.994 235 293 GO:0004601
GO:0005829
GO:0020037
GO:0046872
AF-A0A2S8MYZ3-F1-model_v4 deleted 0.9916 46 133
AF-T0YK82-F1-model_v4 Dyp-type peroxidase (EC 1.11.1.-) 0.9884 195 305 GO:0004601
GO:0005829
GO:0020037
GO:0046872
AF-A0A841JKC0-F1-model_v4 Dyp-type peroxidase family 0.9871 162 305 GO:0004601
GO:0005829
GO:0020037
GO:0046872
AF-A0A536L890-F1-model_v4 Dyp-type peroxidase 0.9867 201 305 GO:0004601
GO:0005829
GO:0020037
GO:0046872

Map