F269420

General Info

Members Datasets Scaffolds Average Seq Length
177 140 354 123

Family's Representative Sequence

Representative Sequence 3300003792|Ga0055540_1033807|Ga0055540_10338072
Length 132
Sequence MPIRIVRLGTPRTADEGTRIGTVRRPPRGVPKTEFAKQDWYDVWFPNLAPSVETMKLGQAAQESGDAKDWTAFTKKYRGEMAEPEAQHALALLATLSAQTNFSVGCYCEDESRCHRSLLRALLIDKGAKVSG

Samples

Sample ID Description Type Environment
1 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
95 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
96 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
97 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
98 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
99 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
100 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
101 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
102 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
103 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
104 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
132 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
138 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
139 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
140 2841917233 Bosea caraganae RCAM04680 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.21
Nodule 1.13
Rhizoplane 1.13
Rhizosphere 84.75
Stem 0
Stem Tuber 0
Unclassified 9.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1033807 3300003792 Bacteria 1156
2 MBSR1b_contig_1069873 2162886012 Bacteria 1072
3 JGI25155J39150_1000002 3300002704 Bacteria 292156
4 JGI25156J39149_1000003 3300002705 Bacteria 305434
5 JGI25154J39366_1000009 3300002738 Bacteria 305408
6 JGI25157J39369_1000002 3300002741 Bacteria 305434
7 JGI25150J39212_1001317 3300002774 Bacteria 7064
8 JGI25151J46595_10035758 3300003187 Bacteria 1882
9 rootL2_10135020 3300003322 Bacteria 2726
10 rootH1_10038078 3300003323 Bacteria 1083
11 Ga0055531_10000031 3300003794 Bacteria 156686
12 JGI25405J52794_10000447 3300003911 Bacteria 5831
13 Ga0065704_10228977 3300005289 Bacteria 1049
14 Ga0065707_10016480 3300005295 Bacteria 2515
15 Ga0070658_10040145 3300005327 Bacteria 3776
16 Ga0070677_10016921 3300005333 Bacteria 2603
17 Ga0068869_100732952 3300005334 Bacteria 845
18 Ga0070666_10755035 3300005335 Bacteria 715
19 Ga0070666_10924366 3300005335 Bacteria 645
20 Ga0070660_100709034 3300005339 Bacteria 844
21 Ga0070689_100018478 3300005340 Bacteria 5137
22 Ga0070661_100788076 3300005344 Bacteria 779
23 Ga0070668_100066057 3300005347 Bacteria 2806
24 Ga0070675_100316611 3300005354 Bacteria 1378
25 Ga0070671_101154719 3300005355 Bacteria 681
26 Ga0070674_100062529 3300005356 Unclassified 2602
27 Ga0070700_100718716 3300005441 Bacteria 796
28 Ga0070708_101261153 3300005445 Unclassified 691
29 Ga0070678_100110238 3300005456 Bacteria 2152
30 Ga0070678_100543284 3300005456 Bacteria 1031
31 Ga0068867_100922234 3300005459 Bacteria 787
32 Ga0070685_11146436 3300005466 Bacteria 589
33 Ga0070707_100383204 3300005468 Unclassified 1366
34 Ga0070698_100663822 3300005471 Unclassified 984
35 Ga0070679_101485892 3300005530 Unclassified 624
36 Ga0070697_100223371 3300005536 Bacteria 1605
37 Ga0070672_100038623 3300005543 Bacteria 3650
38 Ga0070696_100995246 3300005546 Bacteria 700
39 Ga0070696_101408503 3300005546 Bacteria 594
40 Ga0070696_101881357 3300005546 Bacteria 518
41 Ga0070664_100310844 3300005564 Bacteria 1426
42 Ga0068859_100023155 3300005617 Bacteria 6231
43 Ga0068859_101575536 3300005617 Bacteria 725
44 Ga0068862_100254380 3300005844 Bacteria 1602
45 Ga0068862_100548938 3300005844 Bacteria 1103
46 Ga0081455_10000456 3300005937 Bacteria 53636
47 Ga0081455_10082519 3300005937 Bacteria 2629
48 Ga0081455_10261550 3300005937 Bacteria 1260
49 Ga0081540_1092747 3300005983 Bacteria 1324
50 Ga0070715_10413375 3300006163 Bacteria 753
51 Ga0070716_100694221 3300006173 Bacteria 777
52 Ga0070712_100265461 3300006175 Bacteria 1377
53 Ga0075366_10149993 3300006195 Bacteria 1411
54 Ga0075428_100061844 3300006844 Bacteria 4100
55 Ga0075428_100163107 3300006844 Bacteria 2418
56 Ga0075430_100044036 3300006846 Bacteria 3774
57 Ga0075430_100902395 3300006846 Bacteria 728
58 Ga0075431_100404961 3300006847 Bacteria 1365
59 Ga0075433_10353516 3300006852 Bacteria 1298
60 Ga0075433_10381458 3300006852 Bacteria 1244
61 Ga0075434_100348279 3300006871 Bacteria 1502
62 Ga0075434_100879779 3300006871 Unclassified 911
63 Ga0075434_101876010 3300006871 Bacteria 605
64 Ga0075429_100062948 3300006880 Bacteria 3232
65 Ga0075436_100372189 3300006914 Bacteria 1032
66 Ga0097620_100023155 3300006931 Bacteria 6231
67 Ga0097620_101575280 3300006931 Bacteria 725
68 Ga0075435_100058315 3300007076 Bacteria 3126
69 Ga0075435_100201197 3300007076 Bacteria 1688
70 Ga0075435_100300620 3300007076 Bacteria 1372
71 Ga0114129_10655496 3300009147 Bacteria 1354
72 Ga0114129_11388034 3300009147 Bacteria 867
73 Ga0114129_11646169 3300009147 Unclassified 785
74 Ga0114129_12389447 3300009147 Unclassified 633
75 Ga0105238_10134528 3300009551 Bacteria 2450
76 Ga0163163_12072862 3300014325 Unclassified 628
77 Ga0163161_11967774 3300017792 Bacteria 520
78 Ga0209435_100001 3300025206 Bacteria 1424171
79 Ga0207425_1000337 3300025245 Bacteria 32537
80 Ga0209646_1000001 3300025246 Bacteria 3092932
81 Ga0209026_1000003 3300025250 Bacteria 1060571
82 Ga0209759_1000001 3300025256 Bacteria 2799452
83 Ga0209025_1005186 3300025294 Bacteria 10770
84 Ga0209758_1000354 3300025297 Bacteria 83217
85 Ga0209050_1017962 3300025298 Bacteria 2782
86 Ga0209051_1019341 3300025303 Bacteria 2976
87 Ga0209257_1000016 3300025304 Bacteria 908015
88 Ga0207653_10370338 3300025885 Bacteria 561
89 Ga0207680_10402928 3300025903 Bacteria 967
90 Ga0207684_10239956 3300025910 Unclassified 1564
91 Ga0207649_10545470 3300025920 Bacteria 886
92 Ga0207681_10078215 3300025923 Bacteria 2327
93 Ga0207694_10577625 3300025924 Bacteria 944
94 Ga0207659_10793900 3300025926 Bacteria 813
95 Ga0207706_11284059 3300025933 Bacteria 605
96 Ga0207709_10454120 3300025935 Bacteria 991
97 Ga0207691_10006631 3300025940 Bacteria 11172
98 Ga0207691_10080735 3300025940 Bacteria 2924
99 Ga0207679_10139317 3300025945 Bacteria 1959
100 Ga0207679_10315952 3300025945 Bacteria 1351
101 Ga0207668_10171797 3300025972 Bacteria 1701
102 Ga0207668_10262987 3300025972 Bacteria 1407
103 Ga0207640_11040000 3300025981 Bacteria 722
104 Ga0207639_10494479 3300026041 Bacteria 1116
105 Ga0207648_10834558 3300026089 Bacteria 859
106 Ga0207683_10036389 3300026121 Bacteria 4286
107 Ga0207683_10749331 3300026121 Bacteria 906
108 Ga0210000_1058051 3300027462 Bacteria 625
109 Ga0210002_1034249 3300027617 Unclassified 851
110 Ga0268265_10138359 3300028380 Bacteria 2035
111 Ga0307513_10000010 3300031456 Bacteria 360812
112 Ga0307513_10000014 3300031456 Bacteria 303157
113 Ga0307408_100060084 3300031548 Bacteria 2770
114 Ga0307413_10165745 3300031824 Bacteria 1558
115 Ga0307411_11753071 3300032005 Unclassified 576
116 Ga0373931_0467670 3300035691 Bacteria 809
117 Ga0395905_0569468 3300037471 Bacteria 1034
118 Ga0439461_0025677 3300041410 Bacteria 1198
119 Ga0439465_0004478 3300041413 Bacteria 4516
120 Ga0439431_0139648 3300041997 Bacteria 684
121 Ga0439449_0036157 3300042007 Bacteria 1837
122 Ga0439450_088129 3300042008 Bacteria 778
123 Ga0450923_009655 3300042125 Bacteria 1694
124 Ga0450894_034908 3300042131 Bacteria 710
125 Ga0450898_093470 3300042134 Bacteria 622
126 Ga0450910_016653 3300042147 Bacteria 1090
127 Ga0439446_0041563 3300042156 Bacteria 1355
128 Ga0439434_0017738 3300042435 Bacteria 2131
129 Ga0453684_0664230 3300044712 Bacteria 1136
130 Ga0466957_0119074 3300044842 Bacteria 1682
131 Ga0451576_0552839 3300045051 Bacteria 1209
132 Ga0451576_2635086 3300045051 Bacteria 512
133 Ga0495641_0122599 3300046461 Bacteria 1160
134 Ga0495639_0132576 3300046475 Bacteria 1194
135 Ga0495662_0331769 3300046476 Bacteria 748
136 Ga0495667_0950002 3300046559 Bacteria 526
137 Ga0495635_0124729 3300046663 Bacteria 1756
138 Ga0495600_0456543 3300046809 Bacteria 789
139 Ga0495680_0081049 3300047322 Bacteria 2451
140 Ga0495680_0109801 3300047322 Bacteria 2045
141 Ga0495684_0358210 3300047471 Bacteria 1034
142 Ga0496104_0351043 3300048907 Bacteria 1388
143 Ga0496105_0453633 3300048908 Unclassified 1012
144 Ga0501038_0490065 3300049574 Bacteria 941
145 Ga0501040_0888153 3300049576 Bacteria 645
146 Ga0501071_0042086 3300049587 Bacteria 3271
147 Ga0501073_0332007 3300049589 Bacteria 1050
148 Ga0501074_0352575 3300049590 Bacteria 1044
149 Ga0501076_0161925 3300049592 Bacteria 1823
150 Ga0501079_0528507 3300049741 Bacteria 927
151 Ga0501080_0343323 3300049742 Bacteria 1349
152 nmdc:mga05p37_1483516_c1 3300050507 Unclassified 677
153 nmdc:mga05p37_1801761_c1 3300050507 Bacteria 591
154 nmdc:mga05p37_559948_c1 3300050507 Bacteria 1299
155 nmdc:mga09592_1425909_c1 3300050508 Unclassified 566
156 nmdc:mga09592_495915_c1 3300050508 Bacteria 1052
157 nmdc:mga0qj67_1410500_c1 3300050509 Bacteria 537
158 nmdc:mga06r32_1338242_c1 3300050510 Bacteria 659
159 nmdc:mga06r32_26837_c1 3300050510 Bacteria 5374
160 nmdc:mga06r32_875523_c1 3300050510 Bacteria 856
161 nmdc:mga0n895_143976_c1 3300050512 Bacteria 2413
162 nmdc:mga0n895_250352_c1 3300050512 Bacteria 1798
163 nmdc:mga0n895_329288_c1 3300050512 Bacteria 1548
164 nmdc:mga0rr50_128097_c1 3300050513 Bacteria 2029
165 nmdc:mga0rr50_165352_c1 3300050513 Bacteria 1799
166 nmdc:mga08x19_441894_c1 3300050514 Bacteria 915
167 nmdc:mga0a205_216201_c1 3300050515 Bacteria 1804
168 nmdc:mga0a205_264605_c1 3300050515 Bacteria 1597
169 nmdc:mga0a205_465392_c1 3300050515 Bacteria 1124
170 Ga0495601_0342379 3300053077 Unclassified 973
171 Ga0501084_0383094 3300054114 Bacteria 1188
172 Ga0590077_077744 3300059426 Bacteria 762
173 Ga0501082_0067250 3300060353 Bacteria 3086
174 Ga0530510_0008941 3300061734 Bacteria 7016
175 Ga0530510_0094861 3300061734 Bacteria 2179
176 2841915685 2841911363 Bacteria 6173697
177 2841920887 2841917233 Bacteria 6173500
178 Ga0055540_1033807
179 MBSR1b_contig_1069873
180 JGI25155J39150_1000002
181 JGI25156J39149_1000003
182 JGI25154J39366_1000009
183 JGI25157J39369_1000002
184 JGI25150J39212_1001317
185 JGI25151J46595_10035758
186 rootL2_10135020
187 rootH1_10038078
188 Ga0055531_10000031
189 JGI25405J52794_10000447
190 Ga0065704_10228977
191 Ga0065707_10016480
192 Ga0070658_10040145
193 Ga0070677_10016921
194 Ga0068869_100732952
195 Ga0070666_10755035
196 Ga0070666_10924366
197 Ga0070660_100709034
198 Ga0070689_100018478
199 Ga0070661_100788076
200 Ga0070668_100066057
201 Ga0070675_100316611
202 Ga0070671_101154719
203 Ga0070674_100062529
204 Ga0070700_100718716
205 Ga0070708_101261153
206 Ga0070678_100110238
207 Ga0070678_100543284
208 Ga0068867_100922234
209 Ga0070685_11146436
210 Ga0070707_100383204
211 Ga0070698_100663822
212 Ga0070679_101485892
213 Ga0070697_100223371
214 Ga0070672_100038623
215 Ga0070696_100995246
216 Ga0070696_101408503
217 Ga0070696_101881357
218 Ga0070664_100310844
219 Ga0068859_100023155
220 Ga0068859_101575536
221 Ga0068862_100254380
222 Ga0068862_100548938
223 Ga0081455_10000456
224 Ga0081455_10082519
225 Ga0081455_10261550
226 Ga0081540_1092747
227 Ga0070715_10413375
228 Ga0070716_100694221
229 Ga0070712_100265461
230 Ga0075366_10149993
231 Ga0075428_100061844
232 Ga0075428_100163107
233 Ga0075430_100044036
234 Ga0075430_100902395
235 Ga0075431_100404961
236 Ga0075433_10353516
237 Ga0075433_10381458
238 Ga0075434_100348279
239 Ga0075434_100879779
240 Ga0075434_101876010
241 Ga0075429_100062948
242 Ga0075436_100372189
243 Ga0097620_100023155
244 Ga0097620_101575280
245 Ga0075435_100058315
246 Ga0075435_100201197
247 Ga0075435_100300620
248 Ga0114129_10655496
249 Ga0114129_11388034
250 Ga0114129_11646169
251 Ga0114129_12389447
252 Ga0105238_10134528
253 Ga0163163_12072862
254 Ga0163161_11967774
255 Ga0209435_100001
256 Ga0207425_1000337
257 Ga0209646_1000001
258 Ga0209026_1000003
259 Ga0209759_1000001
260 Ga0209025_1005186
261 Ga0209758_1000354
262 Ga0209050_1017962
263 Ga0209051_1019341
264 Ga0209257_1000016
265 Ga0207653_10370338
266 Ga0207680_10402928
267 Ga0207684_10239956
268 Ga0207649_10545470
269 Ga0207681_10078215
270 Ga0207694_10577625
271 Ga0207659_10793900
272 Ga0207706_11284059
273 Ga0207709_10454120
274 Ga0207691_10006631
275 Ga0207691_10080735
276 Ga0207679_10139317
277 Ga0207679_10315952
278 Ga0207668_10171797
279 Ga0207668_10262987
280 Ga0207640_11040000
281 Ga0207639_10494479
282 Ga0207648_10834558
283 Ga0207683_10036389
284 Ga0207683_10749331
285 Ga0210000_1058051
286 Ga0210002_1034249
287 Ga0268265_10138359
288 Ga0307513_10000010
289 Ga0307513_10000014
290 Ga0307408_100060084
291 Ga0307413_10165745
292 Ga0307411_11753071
293 Ga0373931_0467670
294 Ga0395905_0569468
295 Ga0439461_0025677
296 Ga0439465_0004478
297 Ga0439431_0139648
298 Ga0439449_0036157
299 Ga0439450_088129
300 Ga0450923_009655
301 Ga0450894_034908
302 Ga0450898_093470
303 Ga0450910_016653
304 Ga0439446_0041563
305 Ga0439434_0017738
306 Ga0453684_0664230
307 Ga0466957_0119074
308 Ga0451576_0552839
309 Ga0451576_2635086
310 Ga0495641_0122599
311 Ga0495639_0132576
312 Ga0495662_0331769
313 Ga0495667_0950002
314 Ga0495635_0124729
315 Ga0495600_0456543
316 Ga0495680_0081049
317 Ga0495680_0109801
318 Ga0495684_0358210
319 Ga0496104_0351043
320 Ga0496105_0453633
321 Ga0501038_0490065
322 Ga0501040_0888153
323 Ga0501071_0042086
324 Ga0501073_0332007
325 Ga0501074_0352575
326 Ga0501076_0161925
327 Ga0501079_0528507
328 Ga0501080_0343323
329 nmdc:mga05p37_1483516_c1
330 nmdc:mga05p37_1801761_c1
331 nmdc:mga05p37_559948_c1
332 nmdc:mga09592_1425909_c1
333 nmdc:mga09592_495915_c1
334 nmdc:mga0qj67_1410500_c1
335 nmdc:mga06r32_1338242_c1
336 nmdc:mga06r32_26837_c1
337 nmdc:mga06r32_875523_c1
338 nmdc:mga0n895_143976_c1
339 nmdc:mga0n895_250352_c1
340 nmdc:mga0n895_329288_c1
341 nmdc:mga0rr50_128097_c1
342 nmdc:mga0rr50_165352_c1
343 nmdc:mga08x19_441894_c1
344 nmdc:mga0a205_216201_c1
345 nmdc:mga0a205_264605_c1
346 nmdc:mga0a205_465392_c1
347 Ga0495601_0342379
348 Ga0501084_0383094
349 Ga0590077_077744
350 Ga0501082_0067250
351 Ga0530510_0008941
352 Ga0530510_0094861
353 2841915685
354 2841920887

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22751

DUF488-N3a

Active DUF488-N3 subclade

3

127

0.96

PF04343

DUF488

Domain of unknown function DUF488

4

123

0.84

PF22752

DUF488-N3i

Inactive DUF488-N3 subclade

2

131

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tjl-assembly1.cif.gz_A-2 crystal structure of de novo designed protein, sewn0.1 0.5997 53 93
2ehl-assembly1.cif.gz_B crystal structure of thr146 to arg mutant of diphthine synthase 0.5671 1 128
1vhv-assembly1.cif.gz_A crystal structure of diphthine synthase 0.5405 1 128
4onj-assembly1.cif.gz_B crystal structure of the catalytic domain of ntdrm 0.523 85 123
2el0-assembly1.cif.gz_B structural study of project id ph0725 from pyrococcus horikoshii ot3 (l21m) 0.5165 1 128
ID Description Score Start End Superfamily
1vhvB01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.5562 1 128 3.40.1010.10
af_K7MIR4_1_151_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.552 53 95 1.25.40.10
1vhvB01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.533 1 128 3.40.1010.10
2cbfA01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.5178 2 128 3.40.1010.10
af_P60664_1_258_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.5122 84 128 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A519ZC59-F1-model_v4 DUF488 family protein 0.9974 21 128
AF-A0A157ZQZ9-F1-model_v4 DUF488 domain-containing protein 0.9968 1 128
AF-A0A375BAR4-F1-model_v4 deleted 0.9964 1 128
AF-A0A375J012-F1-model_v4 DUF488 domain-containing protein 0.9961 1 128
AF-A0A157Z7I5-F1-model_v4 DUF488 domain-containing protein 0.9957 1 125

Map