F269017

General Info

Members Datasets Scaffolds Average Seq Length
176 126 170 408

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0055800|Ga0501033_0055800_1224_2603
Length 459
Sequence MAETKVAPAQQDTEAGHALPPDGSARDLRPPAEAMDGAAANGSGQSDPTAGRPGGSGAFGRGSNQAGVRLYNERLVLSLIRHHSSLPKADIARLTGLTPQTISLIINQLTADGLLLKGKPQRGRVGQPSVPYSLNPEGAFSFGLKIGRRSADLYLINFDGKVLKLLHEVYRYPTPEGIRRFAVEGVDELLQGLPAEWIGRIAGLGIAAPYEMWTWPEELGAPQADCDAWRTADMRAELARFCSWPVYFHNDITAACAAELMFGRGSDYIDYLYVFIGSFIGGGLVLDGHLFPGRTLNAGALGSIPAHDADPAAPQLMNRASIYVLERKLEAQGRNADILWRSPDDWGDDLGPALDEWIEEVAVSLAYAIIAAIAVIDVETVIIDGAFPRHVRARIIERTRWAIERINRQGLSPFTLVEGSIGNAARAMGGAAIPLLANFTQDREVLFKDRPAASPLAHN

Samples

Sample ID Description Type Environment
1 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
2 2643221629 Devosia sp. Root105 Isolate Unclassified
3 2643221662 Devosia sp. Root413D1 Isolate Unclassified
4 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
5 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
6 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
50 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
52 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
53 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
54 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
73 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
95 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
99 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
100 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
101 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
102 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
103 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
104 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
121 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
122 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
123 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.02
Metatranscriptomes 0
Isolates 3.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.09
Nodule 0
Rhizoplane 1.14
Rhizosphere 74.43
Stem 0
Stem Tuber 0
Unclassified 15.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1000026 3300002774 Bacteria 107804
2 JGI25159J45721_1000003 3300002987 Bacteria 274069
3 JGI25151J46595_10000053 3300003187 Bacteria 156841
4 JGI25151J46595_10005983 3300003187 Bacteria 6193
5 JGI25153J46596_10002629 3300003215 Bacteria 10274
6 rootH2_10102181 3300003320 Bacteria 2848
7 rootH1_10035930 3300003316 Bacteria 3678
8 rootH1_10035930 3300003323 Bacteria 9579
9 rootH1_10162429 3300003323 Bacteria 2247
10 Ga0070658_10002384 3300005327 Bacteria 15783
11 Ga0070658_10068797 3300005327 Bacteria 2895
12 Ga0070660_100004356 3300005339 Bacteria 9776
13 Ga0070661_100002956 3300005344 Bacteria 11725
14 Ga0070661_100036130 3300005344 Bacteria 3591
15 Ga0070675_100164027 3300005354 Bacteria 1913
16 Ga0070674_100022599 3300005356 Bacteria 4059
17 Ga0070659_100009384 3300005366 Bacteria 7186
18 Ga0070667_100174466 3300005367 Bacteria 1899
19 Ga0070708_100003610 3300005445 Bacteria 12141
20 Ga0070663_100071887 3300005455 Bacteria 2518
21 Ga0070706_100001248 3300005467 Bacteria 27231
22 Ga0070706_100054817 3300005467 Bacteria 3680
23 Ga0070707_100006738 3300005468 Bacteria 10645
24 Ga0070698_100004303 3300005471 Bacteria 15664
25 Ga0070698_100264973 3300005471 Bacteria 1650
26 Ga0070699_100045636 3300005518 Bacteria 3793
27 Ga0068853_100100268 3300005539 Bacteria 2560
28 Ga0070696_100013007 3300005546 Bacteria 5584
29 Ga0070665_100204844 3300005548 Unclassified 1973
30 Ga0068855_100043568 3300005563 Bacteria 5315
31 Ga0068855_100254769 3300005563 Bacteria 1957
32 Ga0068857_100037943 3300005577 Bacteria 4268
33 Ga0068856_100029490 3300005614 Bacteria 5359
34 Ga0068856_100349392 3300005614 Bacteria 1497
35 Ga0068852_100005219 3300005616 Bacteria 9263
36 Ga0068852_100007676 3300005616 Bacteria 7890
37 Ga0068852_100124986 3300005616 Bacteria 2360
38 Ga0068862_100129418 3300005844 Bacteria 2232
39 Ga0081538_10002139 3300005981 Bacteria 19677
40 Ga0070717_10004154 3300006028 Bacteria 10436
41 Ga0075428_100180430 3300006844 Bacteria 2286
42 Ga0068865_100121989 3300006881 Bacteria 1940
43 Ga0111539_10000600 3300009094 Bacteria 46579
44 Ga0105241_10028332 3300009174 Bacteria 4174
45 Ga0105238_10078272 3300009551 Bacteria 3297
46 Ga0105239_10027356 3300010375 Bacteria 6278
47 Ga0105239_10095224 3300010375 Bacteria 3289
48 Ga0157371_10013041 3300013102 Bacteria 6328
49 Ga0157370_10009366 3300013104 Bacteria 10474
50 Ga0157370_10013336 3300013104 Bacteria 8465
51 Ga0157369_10019547 3300013105 Bacteria 7579
52 Ga0157369_10180756 3300013105 Bacteria 2219
53 Ga0157372_10208452 3300013307 Bacteria 2265
54 Ga0157380_10004591 3300014326 Bacteria 9590
55 Ga0213872_10094727 3300021361 Bacteria 1334
56 Ga0213876_10017686 3300021384 Bacteria 3761
57 Ga0213871_10007224 3300021441 Unclassified 2391
58 Ga0207427_102135 3300025231 Bacteria 5716
59 Ga0207425_1000104 3300025245 Bacteria 79793
60 Ga0209129_1000181 3300025258 Bacteria 89982
61 Ga0209233_1001631 3300025261 Bacteria 8730
62 Ga0209673_1016610 3300025273 Bacteria 2743
63 Ga0209025_1000181 3300025294 Bacteria 156894
64 Ga0209758_1000156 3300025297 Bacteria 156894
65 Ga0207645_10028450 3300025907 Bacteria 3607
66 Ga0207705_10003617 3300025909 Bacteria 11774
67 Ga0207684_10000434 3300025910 Bacteria 55507
68 Ga0207684_10072784 3300025910 Bacteria 2919
69 Ga0207707_10313696 3300025912 Bacteria 1355
70 Ga0207657_10003579 3300025919 Bacteria 16574
71 Ga0207657_10006840 3300025919 Bacteria 11765
72 Ga0207646_10008095 3300025922 Bacteria 10594
73 Ga0207694_10027023 3300025924 Bacteria 4369
74 Ga0207669_10002893 3300025937 Bacteria 7365
75 Ga0207667_10008878 3300025949 Bacteria 11896
76 Ga0207667_10023438 3300025949 Bacteria 6797
77 Ga0207678_10056960 3300026067 Bacteria 3364
78 Ga0207702_10008133 3300026078 Bacteria 8875
79 Ga0207702_10034572 3300026078 Bacteria 4226
80 Ga0207674_10114636 3300026116 Bacteria 2667
81 Ga0207675_100079553 3300026118 Bacteria 3072
82 Ga0207675_100255105 3300026118 Unclassified 1698
83 Ga0207698_10009753 3300026142 Bacteria 6133
84 Ga0207428_10001207 3300027907 Bacteria 27710
85 Ga0265330_10007858 3300031235 Bacteria 5171
86 Ga0265330_10023851 3300031235 Bacteria 2776
87 Ga0265328_10019046 3300031239 Bacteria 2641
88 Ga0265325_10037129 3300031241 Bacteria 2576
89 Ga0265340_10000264 3300031247 Bacteria 27200
90 Ga0265339_10010627 3300031249 Bacteria 5708
91 Ga0265339_10022915 3300031249 Bacteria 3612
92 Ga0265316_10009686 3300031344 Bacteria 8845
93 Ga0265313_10006384 3300031595 Bacteria 8365
94 Ga0265314_10015010 3300031711 Bacteria 6167
95 Ga0265342_10007507 3300031712 Bacteria 7977
96 Ga0265342_10060829 3300031712 Bacteria 2226
97 Ga0307516_10053978 3300031730 Bacteria 3928
98 Ga0307407_10020794 3300031903 Bacteria 3370
99 Ga0307412_10022169 3300031911 Bacteria 3890
100 Ga0307412_10039363 3300031911 Unclassified 3051
101 Ga0307416_100073267 3300032002 Bacteria 2855
102 Ga0307414_10055137 3300032004 Bacteria 2782
103 Ga0307414_10093293 3300032004 Unclassified 2243
104 Ga0373931_0009893 3300035691 Bacteria 4568
105 Ga0373925_0147774 3300037068 Bacteria 1843
106 Ga0395898_0083765 3300037466 Bacteria 3073
107 Ga0436365_0562176 3300039437 Bacteria 3698
108 Ga0436365_0596749 3300039437 Bacteria 23938
109 Ga0436360_0840270 3300039438 Bacteria 4653
110 Ga0436360_1035629 3300039438 Bacteria 1795
111 Ga0436361_0067957 3300039447 Unclassified 2113
112 Ga0436361_0396022 3300039447 Bacteria 2206
113 Ga0436361_0569675 3300039447 Bacteria 5998
114 Ga0436363_1157952 3300039450 Unclassified 4144
115 Ga0451576_0141212 3300045051 Bacteria 2511
116 Ga0495672_0105082 3300047320 Bacteria 1525
117 Ga0495686_0066305 3300047472 Bacteria 2231
118 Ga0495686_0117963 3300047472 Bacteria 1585
119 Ga0496101_0257460 3300048904 Unclassified 1360
120 Ga0496111_0041994 3300048914 Bacteria 3283
121 Ga0496116_0011088 3300048919 Bacteria 7496
122 Ga0496117_0005505 3300048920 Bacteria 13264
123 Ga0496119_0028529 3300048922 Bacteria 3806
124 Ga0496121_0106973 3300048924 Bacteria 2143
125 Ga0496121_0161225 3300048924 Unclassified 1639
126 Ga0496122_0010267 3300048925 Bacteria 9692
127 Ga0496122_0107655 3300048925 Bacteria 1841
128 Ga0496124_0031884 3300048927 Bacteria 4661
129 Ga0496124_0039317 3300048927 Bacteria 4101
130 Ga0496124_0130987 3300048927 Bacteria 1992
131 Ga0496125_0000290 3300048928 Bacteria 99343
132 Ga0496125_0000376 3300048928 Bacteria 83515
133 Ga0496125_0001401 3300048928 Bacteria 35263
134 Ga0496125_0104821 3300048928 Bacteria 2069
135 Ga0496125_0114256 3300048928 Unclassified 1945
136 Ga0501031_0011362 3300049568 Bacteria 5798
137 Ga0501032_0057177 3300049569 Bacteria 2621
138 Ga0501033_0055800 3300049570 Bacteria 2920
139 Ga0501034_0035062 3300049571 Bacteria 5088
140 Ga0501034_0068313 3300049571 Bacteria 3564
141 Ga0501034_0102536 3300049571 Bacteria 2855
142 Ga0501034_0245926 3300049571 Bacteria 1734
143 Ga0501036_0025484 3300049572 Bacteria 4989
144 Ga0501036_0145528 3300049572 Bacteria 1999
145 Ga0501037_0040584 3300049573 Bacteria 3425
146 Ga0501038_0052399 3300049574 Bacteria 3518
147 Ga0501043_0291571 3300049579 Bacteria 1249
148 Ga0501046_0071297 3300049580 Bacteria 2700
149 Ga0501046_0124797 3300049580 Bacteria 1957
150 Ga0501047_0010891 3300049581 Bacteria 8598
151 Ga0501047_0049556 3300049581 Bacteria 4055
152 Ga0501047_0226954 3300049581 Bacteria 1722
153 Ga0501070_0014927 3300049586 Bacteria 6534
154 Ga0501070_0057526 3300049586 Bacteria 3223
155 Ga0501073_0199438 3300049589 Bacteria 1384
156 Ga0501073_0309674 3300049589 Bacteria 1089
157 Ga0501035_0005035 3300049822 Bacteria 12519
158 Ga0501035_0039446 3300049822 Bacteria 4273
159 Ga0501044_0018787 3300049823 Bacteria 7405
160 Ga0501044_0040143 3300049823 Bacteria 4879
161 Ga0501044_0095867 3300049823 Bacteria 2989
162 Ga0501044_0177605 3300049823 Bacteria 2098
163 nmdc:mga08y16_16_c1 3300050511 Bacteria 386948
164 Ga0500555_008752 3300053103 Bacteria 2889
165 Ga0500595_017751 3300053119 Bacteria 2619
166 Ga0500604_0000260 3300053151 Bacteria 14903
167 Ga0500634_0000002 3300053161 Bacteria 252372
168 Ga0501084_0127434 3300054114 Unclassified 2142
169 Ga0501084_0279174 3300054114 Bacteria 1410
170 Ga0501082_0023929 3300060353 Bacteria 5267

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025912 Ga0207707_10313696 Ga0207707_103136962 334
2 3300039438 Ga0436360_1035629 Ga0436360_1035629_683_1723 344
3 3300049589 Ga0501073_0309674 Ga0501073_0309674_14_1057 345
4 3300039450 Ga0436363_1157952 Ga0436363_1157952_2252_3298 347
5 3300049580 Ga0501046_0124797 Ga0501046_0124797_11_1117 366
6 3300049579 Ga0501043_0291571 Ga0501043_0291571_25_1236 376
7 3300048922 Ga0496119_0028529 Ga0496119_0028529_1000_2223 377
8 3300048928 Ga0496125_0000290 Ga0496125_0000290_90121_91344 377
9 3300048925 Ga0496122_0010267 Ga0496122_0010267_4442_5725 379
10 3300048928 Ga0496125_0000376 Ga0496125_0000376_9509_10792 379
11 3300053119 Ga0500595_017751 Ga0500595_017751_1122_2291 385
12 3300003323 rootH1_10035930 rootH1_100359309 386
13 3300005344 Ga0070661_100036130 Ga0070661_1000361303 386
14 3300005563 Ga0068855_100254769 Ga0068855_1002547691 386
15 3300005614 Ga0068856_100349392 Ga0068856_1003493922 386
16 3300005616 Ga0068852_100005219 Ga0068852_1000052192 386
17 3300013102 Ga0157371_10013041 Ga0157371_100130416 386
18 3300013104 Ga0157370_10009366 Ga0157370_100093666 386
19 3300013105 Ga0157369_10180756 Ga0157369_101807562 386
20 3300013307 Ga0157372_10208452 Ga0157372_102084522 386
21 3300026078 Ga0207702_10008133 Ga0207702_100081336 386
22 3300037466 Ga0395898_0083765 Ga0395898_0083765_267_1508 386
23 3300005354 Ga0070675_100164027 Ga0070675_1001640271 387
24 3300005366 Ga0070659_100009384 Ga0070659_1000093844 387
25 3300005577 Ga0068857_100037943 Ga0068857_1000379432 387
26 3300005616 Ga0068852_100007676 Ga0068852_1000076762 387
27 3300025907 Ga0207645_10028450 Ga0207645_100284501 387
28 3300025919 Ga0207657_10006840 Ga0207657_100068403 387
29 3300026116 Ga0207674_10114636 Ga0207674_101146362 387
30 3300031911 Ga0307412_10022169 Ga0307412_100221691 387
31 3300009174 Ga0105241_10028332 Ga0105241_100283322 389
32 3300010375 Ga0105239_10027356 Ga0105239_100273566 389
33 3300035691 Ga0373931_0009893 Ga0373931_0009893_216_1553 389
34 3300049571 Ga0501034_0068313 Ga0501034_0068313_1760_2998 391
35 3300031235 Ga0265330_10007858 Ga0265330_100078583 395
36 3300031241 Ga0265325_10037129 Ga0265325_100371292 395
37 3300049823 Ga0501044_0177605 Ga0501044_0177605_517_1782 396
38 3300048904 Ga0496101_0257460 Ga0496101_0257460_19_1215 398
39 3300048924 Ga0496121_0161225 Ga0496121_0161225_11_1207 398
40 3300054114 Ga0501084_0127434 Ga0501084_0127434_650_1897 399
41 3300054114 Ga0501084_0279174 Ga0501084_0279174_91_1338 399
42 3300060353 Ga0501082_0023929 Ga0501082_0023929_78_1325 399
43 iso_pu_bacteria 2758568016 2758638051 400
44 3300049571 Ga0501034_0035062 Ga0501034_0035062_438_1655 401
45 3300049571 Ga0501034_0245926 Ga0501034_0245926_373_1611 402
46 iso_pu_bacteria 2582581316 2585336379 403
47 iso_pu_bacteria 2854681122 2854685090 403
48 3300037068 Ga0373925_0147774 Ga0373925_0147774_454_1668 404
49 3300053161 Ga0500634_0000002 Ga0500634_0000002_180100_181314 404
50 3300005367 Ga0070667_100174466 Ga0070667_1001744662 405
51 3300005467 Ga0070706_100054817 Ga0070706_1000548172 405
52 3300025910 Ga0207684_10072784 Ga0207684_100727842 405
53 3300032004 Ga0307414_10055137 Ga0307414_100551372 405
54 3300053151 Ga0500604_0000260 Ga0500604_0000260_3256_4473 405
55 iso_pu_bacteria 2891373044 2891375426 405
56 iso_pu_bacteria 8055431914 8055433133 405
57 iso_pu_bacteria 2643221629 2644167218 406
58 iso_pu_bacteria 2643221662 2644349734 406
59 3300005327 Ga0070658_10068797 Ga0070658_100687972 407
60 3300005339 Ga0070660_100004356 Ga0070660_1000043567 407
61 3300005455 Ga0070663_100071887 Ga0070663_1000718872 407
62 3300005468 Ga0070707_100006738 Ga0070707_1000067386 407
63 3300005518 Ga0070699_100045636 Ga0070699_1000456363 407
64 3300005563 Ga0068855_100043568 Ga0068855_1000435683 407
65 3300025909 Ga0207705_10003617 Ga0207705_100036175 407
66 3300025919 Ga0207657_10003579 Ga0207657_100035798 407
67 3300025922 Ga0207646_10008095 Ga0207646_100080955 407
68 3300025949 Ga0207667_10023438 Ga0207667_100234384 407
69 3300026067 Ga0207678_10056960 Ga0207678_100569603 407
70 3300026118 Ga0207675_100255105 Ga0207675_1002551052 407
71 3300031730 Ga0307516_10053978 Ga0307516_100539783 407
72 3300032004 Ga0307414_10093293 Ga0307414_100932932 407
73 3300047472 Ga0495686_0066305 Ga0495686_0066305_962_2185 407
74 3300047472 Ga0495686_0117963 Ga0495686_0117963_62_1285 407
75 3300053103 Ga0500555_008752 Ga0500555_008752_1451_2674 407
76 3300048919 Ga0496116_0011088 Ga0496116_0011088_6117_7343 408
77 3300048920 Ga0496117_0005505 Ga0496117_0005505_6810_8036 408
78 3300048924 Ga0496121_0106973 Ga0496121_0106973_434_1660 408
79 3300048925 Ga0496122_0107655 Ga0496122_0107655_151_1377 408
80 3300048927 Ga0496124_0039317 Ga0496124_0039317_1665_2891 408
81 3300048927 Ga0496124_0130987 Ga0496124_0130987_460_1686 408
82 3300048928 Ga0496125_0104821 Ga0496125_0104821_379_1605 408
83 3300048928 Ga0496125_0114256 Ga0496125_0114256_465_1691 408
84 3300049568 Ga0501031_0011362 Ga0501031_0011362_2406_3680 408
85 3300049569 Ga0501032_0057177 Ga0501032_0057177_778_2052 408
86 3300049572 Ga0501036_0025484 Ga0501036_0025484_2615_3889 408
87 3300049572 Ga0501036_0145528 Ga0501036_0145528_232_1509 408
88 3300049573 Ga0501037_0040584 Ga0501037_0040584_708_1985 408
89 3300049574 Ga0501038_0052399 Ga0501038_0052399_1173_2447 408
90 3300049580 Ga0501046_0071297 Ga0501046_0071297_533_1807 408
91 3300049581 Ga0501047_0226954 Ga0501047_0226954_306_1580 408
92 3300049586 Ga0501070_0057526 Ga0501070_0057526_1882_3156 408
93 3300049822 Ga0501035_0039446 Ga0501035_0039446_788_2062 408
94 3300049823 Ga0501044_0018787 Ga0501044_0018787_1607_2884 408
95 3300049823 Ga0501044_0040143 Ga0501044_0040143_1182_2456 408
96 3300003187 JGI25151J46595_10005983 JGI25151J46595_100059833 409
97 3300005356 Ga0070674_100022599 Ga0070674_1000225992 409
98 3300005844 Ga0068862_100129418 Ga0068862_1001294182 409
99 3300006881 Ga0068865_100121989 Ga0068865_1001219891 409
100 3300014326 Ga0157380_10004591 Ga0157380_100045919 409
101 3300021384 Ga0213876_10017686 Ga0213876_100176863 409
102 3300021441 Ga0213871_10007224 Ga0213871_100072242 409
103 3300025231 Ga0207427_102135 Ga0207427_1021355 409
104 3300025261 Ga0209233_1001631 Ga0209233_10016316 409
105 3300025937 Ga0207669_10002893 Ga0207669_100028935 409
106 3300026118 Ga0207675_100079553 Ga0207675_1000795531 409
107 3300032002 Ga0307416_100073267 Ga0307416_1000732672 409
108 3300039437 Ga0436365_0596749 Ga0436365_0596749_11369_12604 409
109 3300039438 Ga0436360_0840270 Ga0436360_0840270_3200_4435 409
110 3300039447 Ga0436361_0067957 Ga0436361_0067957_358_1593 409
111 3300039447 Ga0436361_0569675 Ga0436361_0569675_2339_3577 409
112 3300045051 Ga0451576_0141212 Ga0451576_0141212_610_1839 409
113 3300002987 JGI25159J45721_1000003 JGI25159J45721_1000003124 410
114 3300003323 rootH1_10162429 rootH1_101624292 410
115 3300005539 Ga0068853_100100268 Ga0068853_1001002682 410
116 3300005548 Ga0070665_100204844 Ga0070665_1002048442 410
117 3300005614 Ga0068856_100029490 Ga0068856_1000294904 410
118 3300005981 Ga0081538_10002139 Ga0081538_100021392 410
119 3300006844 Ga0075428_100180430 Ga0075428_1001804302 410
120 3300009094 Ga0111539_10000600 Ga0111539_100006003 410
121 3300009551 Ga0105238_10078272 Ga0105238_100782722 410
122 3300025924 Ga0207694_10027023 Ga0207694_100270233 410
123 3300025949 Ga0207667_10008878 Ga0207667_100088782 410
124 3300026078 Ga0207702_10034572 Ga0207702_100345722 410
125 3300027907 Ga0207428_10001207 Ga0207428_1000120714 410
126 3300031239 Ga0265328_10019046 Ga0265328_100190462 410
127 3300031247 Ga0265340_10000264 Ga0265340_100002642 410
128 3300031249 Ga0265339_10022915 Ga0265339_100229153 410
129 3300031344 Ga0265316_10009686 Ga0265316_100096869 410
130 3300031595 Ga0265313_10006384 Ga0265313_100063844 410
131 3300031712 Ga0265342_10007507 Ga0265342_100075074 410
132 3300031903 Ga0307407_10020794 Ga0307407_100207942 410
133 3300047320 Ga0495672_0105082 Ga0495672_0105082_58_1290 410
134 3300048914 Ga0496111_0041994 Ga0496111_0041994_2006_3253 410
135 3300048927 Ga0496124_0031884 Ga0496124_0031884_2722_3969 410
136 3300048928 Ga0496125_0001401 Ga0496125_0001401_16965_18212 410
137 3300049581 Ga0501047_0049556 Ga0501047_0049556_409_1707 410
138 3300049589 Ga0501073_0199438 Ga0501073_0199438_34_1317 410
139 3300049823 Ga0501044_0095867 Ga0501044_0095867_397_1695 410
140 3300050511 nmdc:mga08y16_16_c1 nmdc:mga08y16_16_c1_269378_270616 410
141 3300003320 rootH2_10102181 rootH2_101021812 411
142 3300005327 Ga0070658_10002384 Ga0070658_1000238412 411
143 3300005344 Ga0070661_100002956 Ga0070661_1000029562 411
144 3300005445 Ga0070708_100003610 Ga0070708_1000036109 411
145 3300005467 Ga0070706_100001248 Ga0070706_10000124819 411
146 3300005471 Ga0070698_100004303 Ga0070698_10000430315 411
147 3300005471 Ga0070698_100264973 Ga0070698_1002649731 411
148 3300005546 Ga0070696_100013007 Ga0070696_1000130072 411
149 3300006028 Ga0070717_10004154 Ga0070717_100041546 411
150 3300010375 Ga0105239_10095224 Ga0105239_100952242 411
151 3300013104 Ga0157370_10013336 Ga0157370_100133363 411
152 3300013105 Ga0157369_10019547 Ga0157369_100195478 411
153 3300025910 Ga0207684_10000434 Ga0207684_1000043438 411
154 3300026142 Ga0207698_10009753 Ga0207698_100097532 411
155 3300039437 Ga0436365_0562176 Ga0436365_0562176_1506_2774 411
156 3300049571 Ga0501034_0102536 Ga0501034_0102536_718_1962 411
157 3300005616 Ga0068852_100124986 Ga0068852_1001249861 412
158 3300021361 Ga0213872_10094727 Ga0213872_100947271 412
159 3300031235 Ga0265330_10023851 Ga0265330_100238512 412
160 3300031249 Ga0265339_10010627 Ga0265339_100106274 412
161 3300031711 Ga0265314_10015010 Ga0265314_100150102 412
162 3300031712 Ga0265342_10060829 Ga0265342_100608292 412
163 3300049570 Ga0501033_0055800 Ga0501033_0055800_1224_2603 413
164 3300049581 Ga0501047_0010891 Ga0501047_0010891_1984_3363 413
165 3300049586 Ga0501070_0014927 Ga0501070_0014927_4529_5908 413
166 3300049822 Ga0501035_0005035 Ga0501035_0005035_3648_5027 413
167 3300039447 Ga0436361_0396022 Ga0436361_0396022_114_1370 414
168 3300002774 JGI25150J39212_1000026 JGI25150J39212_100002653 416
169 3300003187 JGI25151J46595_10000053 JGI25151J46595_1000005381 416
170 3300003215 JGI25153J46596_10002629 JGI25153J46596_1000262910 416
171 3300025245 Ga0207425_1000104 Ga0207425_100010465 416
172 3300025258 Ga0209129_1000181 Ga0209129_100018182 416
173 3300025273 Ga0209673_1016610 Ga0209673_10166102 416
174 3300025294 Ga0209025_1000181 Ga0209025_100018165 416
175 3300025297 Ga0209758_1000156 Ga0209758_100015665 416
176 3300031911 Ga0307412_10039363 Ga0307412_100393633 416

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

69

115

0.95

PF00480

ROK

ROK family

141

315

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zup-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9495 50 82
5yhx-assembly1.cif.gz_B structure of lactococcus lactis zitr, wild type 0.9448 34 97
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.943 36 98
5yhx-assembly2.cif.gz_H structure of lactococcus lactis zitr, wild type 0.937 34 97
2vxz-assembly1.cif.gz_A crystal structure of hypothetical protein pyrsv_gp04 from pyrobaculum spherical virus 0.9268 30 97
ID Description Score Start End Superfamily
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.943 36 98 1.10.10.10
af_Q2FY97_1_107_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9366 35 82 1.10.10.10
af_O53151_36_154_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9304 34 101 1.10.10.10
2cfxG01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9228 35 76 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9185 31 97 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A848VZM4-F1-model_v4 ROK family transcriptional regulator 0.968 35 404 GO:0003700
GO:0009384
GO:0019262
AF-A0A832J4Q2-F1-model_v4 ROK family protein 0.9595 112 414 GO:0009384
GO:0019262
AF-A0A832J4Q2-F1-model_v4 ROK family protein 0.9564 112 414 GO:0009384
GO:0019262
AF-A0A848VZM4-F1-model_v4 ROK family transcriptional regulator 0.9502 35 404 GO:0003700
GO:0009384
GO:0019262
AF-A0A1I7A0V4-F1-model_v4 deleted 0.9319 35 403

Feature Viewer

pLDDT pTM Quality
84.62 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map