F268028

General Info

Members Datasets Scaffolds Average Seq Length
176 127 352 406

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10005819|Ga0070717_100058196
Length 472
Sequence MSTPPTNNPQTQTEASPPPQTGGCPFKHPAEIPAAPAGCPVLERDNPAFLQNAHHTYAMLREQGPVVRAPFAQTPLDGVRQDSRAPKQTGVVNQRLFVTRYDEAVEALLDERLSSDFRKGLPPEQRERLAYMPEEAKPLAYSLIMRDAPEHTRLRKLVQPSFTARAMEALRPSIQKITDALLDRAERDAAERGETGPNRRMNLVKAFAHPLPVTVISEMLGIPKEDQAQISAEADRLMNDESLGRDEKRRERFRAFSHYMEQLFERKRQAPGDDMISQMLMTAEDGDKLSHDEMMSMVFLLFFAGHITTVNLIGSGVVALLTHPEQHAKMIADPTLAKGLVEETLRYWGPVDFMGTARLVTDDVKLGETPIAKGELVMIGLASANRDPEKFPNPDAFDITRPEAHRNIAFGKGIHVCLGAPLARLEGQIAFETLFRRYPQMRLAVPVEELKWGVGAGSGAGLRGFSQIPVFF

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
32 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
33 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
34 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
47 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
48 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
49 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
50 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
51 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
52 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
55 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
56 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
57 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
71 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
72 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
79 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
80 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
83 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
84 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
91 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
94 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
95 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
96 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
97 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
102 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
103 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
111 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
115 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
116 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
117 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
118 2558860280 Kutzneria sp. 744 Isolate Unclassified
119 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
120 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
121 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
122 2818991441 Niallia circulans 3243 Isolate Rhizosphere
123 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
124 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
125 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
126 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
127 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.61
Metatranscriptomes 0
Isolates 7.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.7
Nodule 0
Rhizoplane 1.7
Rhizosphere 82.95
Stem 0
Stem Tuber 0
Unclassified 2.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10005819 3300006028 Bacteria 9030
2 rootH2_10001780 3300003320 Bacteria 64551
3 Ga0065707_10002683 3300005295 Bacteria 4673
4 Ga0065707_10095494 3300005295 Bacteria 3360
5 Ga0070689_100139214 3300005340 Bacteria 1951
6 Ga0070709_10235290 3300005434 Bacteria 1313
7 Ga0070714_100164917 3300005435 Bacteria 2007
8 Ga0070706_100000901 3300005467 Bacteria 32562
9 Ga0070706_100007062 3300005467 Bacteria 10576
10 Ga0070707_100000971 3300005468 Bacteria 28355
11 Ga0070707_100227889 3300005468 Unclassified 1814
12 Ga0070698_100288982 3300005471 Unclassified 1571
13 Ga0070699_100002137 3300005518 Bacteria 17924
14 Ga0070679_100037069 3300005530 Bacteria 4841
15 Ga0070697_100072799 3300005536 Bacteria 2820
16 Ga0070697_100080859 3300005536 Bacteria 2677
17 Ga0068853_100013171 3300005539 Bacteria 6749
18 Ga0068853_100115100 3300005539 Bacteria 2393
19 Ga0070696_100032976 3300005546 Bacteria 3556
20 Ga0070664_100087491 3300005564 Bacteria 2694
21 Ga0068857_100022222 3300005577 Bacteria 5581
22 Ga0081455_10002324 3300005937 Bacteria 22682
23 Ga0081539_10003612 3300005985 Bacteria 18689
24 Ga0075365_10041297 3300006038 Bacteria 3013
25 Ga0070712_100005207 3300006175 Bacteria 8044
26 Ga0070712_100097096 3300006175 Bacteria 2171
27 Ga0075430_100000174 3300006846 Bacteria 42563
28 Ga0075431_100038724 3300006847 Bacteria 4911
29 Ga0075433_10002507 3300006852 Bacteria 13968
30 Ga0105240_10084457 3300009093 Bacteria 3893
31 Ga0111539_10369945 3300009094 Bacteria 1668
32 Ga0114129_10001962 3300009147 Bacteria 28150
33 Ga0114129_10079679 3300009147 Unclassified 4553
34 Ga0105237_10090631 3300009545 Bacteria 3046
35 Ga0105237_10163587 3300009545 Bacteria 2224
36 Ga0105237_10178460 3300009545 Bacteria 2124
37 Ga0105238_10022061 3300009551 Bacteria 6490
38 Ga0105238_10078333 3300009551 Bacteria 3295
39 Ga0105249_10031815 3300009553 Bacteria 4772
40 Ga0105239_10456461 3300010375 Bacteria 1450
41 Ga0213873_10000033 3300021358 Bacteria 36320
42 Ga0213876_10004164 3300021384 Bacteria 8113
43 Ga0213876_10011812 3300021384 Bacteria 4657
44 Ga0213876_10074420 3300021384 Bacteria 1794
45 Ga0213875_10000881 3300021388 Bacteria 22029
46 Ga0213875_10051269 3300021388 Bacteria 1933
47 Ga0209566_100054 3300025225 Bacteria 221422
48 Ga0207684_10000298 3300025910 Bacteria 71028
49 Ga0207684_10004685 3300025910 Bacteria 12844
50 Ga0207695_10126206 3300025913 Bacteria 2520
51 Ga0207671_10056673 3300025914 Bacteria 2904
52 Ga0207693_10011048 3300025915 Bacteria 7317
53 Ga0207693_10105230 3300025915 Bacteria 2213
54 Ga0207693_10192824 3300025915 Bacteria 1603
55 Ga0207663_10103318 3300025916 Bacteria 1919
56 Ga0207646_10003916 3300025922 Bacteria 16531
57 Ga0207681_10077593 3300025923 Bacteria 2336
58 Ga0207700_10042643 3300025928 Bacteria 3328
59 Ga0207700_10166855 3300025928 Bacteria 1833
60 Ga0207664_10029842 3300025929 Bacteria 4159
61 Ga0207712_10017497 3300025961 Bacteria 4656
62 Ga0207712_10075550 3300025961 Bacteria 2436
63 Ga0207639_10088269 3300026041 Bacteria 2474
64 Ga0265337_1001491 3300028556 Bacteria 11472
65 Ga0265326_10000845 3300028558 Bacteria 11214
66 Ga0265319_1001683 3300028563 Bacteria 12776
67 Ga0265334_10000121 3300028573 Bacteria 50668
68 Ga0265323_10001684 3300028653 Bacteria 10561
69 Ga0265322_10030588 3300028654 Bacteria 1537
70 Ga0265336_10001936 3300028666 Bacteria 8903
71 Ga0265338_10000059 3300028800 Bacteria 198047
72 Ga0265338_10027480 3300028800 Bacteria 5707
73 Ga0265324_10004673 3300029957 Bacteria 6094
74 Ga0307511_10000324 3300030521 Bacteria 50832
75 Ga0265332_10004871 3300031238 Bacteria 6241
76 Ga0265320_10005653 3300031240 Bacteria 7982
77 Ga0265325_10002259 3300031241 Bacteria 13056
78 Ga0265340_10006472 3300031247 Bacteria 6445
79 Ga0265316_10020883 3300031344 Bacteria 5562
80 Ga0307408_100071268 3300031548 Bacteria 2569
81 Ga0265313_10004322 3300031595 Bacteria 10996
82 Ga0265314_10013406 3300031711 Bacteria 6621
83 Ga0307405_10001195 3300031731 Bacteria 10738
84 Ga0307410_10014901 3300031852 Bacteria 4593
85 Ga0307406_10009320 3300031901 Bacteria 5501
86 Ga0307412_10051973 3300031911 Bacteria 2711
87 Ga0307412_10071045 3300031911 Bacteria 2375
88 Ga0307409_100010943 3300031995 Bacteria 5681
89 Ga0307416_100000750 3300032002 Bacteria 16983
90 Ga0307411_10004850 3300032005 Bacteria 6527
91 Ga0307415_100001242 3300032126 Bacteria 11971
92 Ga0307415_100003829 3300032126 Bacteria 7717
93 Ga0307415_100036275 3300032126 Bacteria 3229
94 Ga0373933_0005145 3300035724 Bacteria 7136
95 Ga0373933_0051643 3300035724 Bacteria 2458
96 Ga0373925_0009041 3300037068 Bacteria 7253
97 Ga0395900_0211597 3300037418 Bacteria 1958
98 Ga0395898_0301003 3300037466 Bacteria 1530
99 Ga0436364_0425205 3300037853 Bacteria 2412
100 Ga0436364_0648810 3300037853 Bacteria 14607
101 Ga0436364_1118079 3300037853 Bacteria 3513
102 Ga0436364_1501980 3300037853 Bacteria 10566
103 Ga0436364_1554164 3300037853 Bacteria 24981
104 Ga0436365_0034724 3300039437 Bacteria 1879
105 Ga0436365_0589592 3300039437 Bacteria 1898
106 Ga0436365_0995223 3300039437 Bacteria 4657
107 Ga0436365_1036137 3300039437 Bacteria 1982
108 Ga0436365_1287264 3300039437 Bacteria 15595
109 Ga0436362_0551347 3300039453 Bacteria 47047
110 Ga0466969_0002301 3300044656 Bacteria 10198
111 Ga0466969_0012020 3300044656 Bacteria 4575
112 Ga0466969_0077905 3300044656 Bacteria 1585
113 Ga0466972_0009052 3300044658 Bacteria 4999
114 Ga0466972_0027272 3300044658 Bacteria 2827
115 Ga0466972_0070215 3300044658 Bacteria 1671
116 Ga0466966_0000466 3300044684 Bacteria 25968
117 Ga0466966_0004002 3300044684 Bacteria 9734
118 Ga0466966_0100284 3300044684 Bacteria 1791
119 Ga0466961_0001382 3300044693 Bacteria 14995
120 Ga0466961_0044870 3300044693 Bacteria 2828
121 Ga0466961_0065493 3300044693 Bacteria 2309
122 Ga0466963_0006864 3300044694 Bacteria 6772
123 Ga0466968_0017805 3300044735 Bacteria 2845
124 Ga0466968_0052885 3300044735 Bacteria 1738
125 Ga0466970_0009054 3300044765 Bacteria 5025
126 Ga0466970_0031996 3300044765 Bacteria 2779
127 Ga0466970_0035270 3300044765 Bacteria 2650
128 Ga0466957_0075174 3300044842 Bacteria 2096
129 Ga0466960_0059249 3300044901 Bacteria 1872
130 Ga0466959_0000691 3300045049 Bacteria 19715
131 Ga0466959_0001964 3300045049 Bacteria 12968
132 Ga0466959_0051785 3300045049 Bacteria 3009
133 Ga0466959_0100755 3300045049 Unclassified 2067
134 Ga0466959_0137288 3300045049 Bacteria 1730
135 Ga0466967_0050330 3300045976 Bacteria 3648
136 Ga0466967_0217704 3300045976 Bacteria 1813
137 Ga0495650_0040900 3300046471 Bacteria 1986
138 Ga0495585_0100799 3300046492 Bacteria 1545
139 Ga0495606_0001048 3300046507 Bacteria 39899
140 Ga0495631_0116897 3300046518 Bacteria 1147
141 Ga0495668_0000246 3300046616 Bacteria 77015
142 Ga0495625_0002894 3300046660 Bacteria 17930
143 Ga0495636_0005664 3300047318 Bacteria 4898
144 Ga0495626_0000124 3300048091 Bacteria 99577
145 Ga0496101_0010931 3300048904 Bacteria 6009
146 Ga0496106_0014308 3300048909 Bacteria 5863
147 Ga0496108_0000379 3300048911 Bacteria 37030
148 Ga0496119_0028886 3300048922 Bacteria 3774
149 Ga0496126_0012943 3300048929 Bacteria 8518
150 Ga0501067_0098610 3300049583 Bacteria 1623
151 Ga0501072_0008427 3300049588 Bacteria 7824
152 Ga0501072_0021714 3300049588 Bacteria 4979
153 Ga0501075_0265428 3300049591 Bacteria 1308
154 Ga0501076_0105257 3300049592 Bacteria 2277
155 Ga0501080_0261861 3300049742 Bacteria 1575
156 Ga0501083_0008233 3300049744 Bacteria 7372
157 nmdc:mga05p37_41098_c1 3300050507 Bacteria 5678
158 nmdc:mga0qj67_9937_c1 3300050509 Bacteria 7097
159 nmdc:mga06r32_5688_c1 3300050510 Bacteria 11222
160 nmdc:mga0n895_47623_c1 3300050512 Bacteria 4192
161 nmdc:mga0a205_3577_c1 3300050515 Bacteria 5666
162 Ga0500646_0000403 3300053090 Bacteria 12818
163 Ga0466962_0018926 3300061719 Bacteria 3309
164 2512733767 2512564039 Bacteria 8739048
165 2515855018 2515154155 Bacteria 7985436
166 2559429884 2558860280 Bacteria 11429938
167 2559431597 2558860280 Bacteria 11429938
168 2616906254 2616644941 Bacteria 8510691
169 2673168551 2671180531 Bacteria 9045424
170 2816511384 2816332139 Bacteria 9138787
171 2819567038 2818991441 Bacteria 5062707
172 2887480813 2887478801 Bacteria 8972725
173 2912715323 2912715099 Bacteria 9460473
174 2936366528 2936361878 Bacteria 5632809
175 3006500427 3006493962 Bacteria 8825450
176 8008575240 8008574985 Bacteria 7815457
177 Ga0070717_10005819
178 rootH2_10001780
179 Ga0065707_10002683
180 Ga0065707_10095494
181 Ga0070689_100139214
182 Ga0070709_10235290
183 Ga0070714_100164917
184 Ga0070706_100000901
185 Ga0070706_100007062
186 Ga0070707_100000971
187 Ga0070707_100227889
188 Ga0070698_100288982
189 Ga0070699_100002137
190 Ga0070679_100037069
191 Ga0070697_100072799
192 Ga0070697_100080859
193 Ga0068853_100013171
194 Ga0068853_100115100
195 Ga0070696_100032976
196 Ga0070664_100087491
197 Ga0068857_100022222
198 Ga0081455_10002324
199 Ga0081539_10003612
200 Ga0075365_10041297
201 Ga0070712_100005207
202 Ga0070712_100097096
203 Ga0075430_100000174
204 Ga0075431_100038724
205 Ga0075433_10002507
206 Ga0105240_10084457
207 Ga0111539_10369945
208 Ga0114129_10001962
209 Ga0114129_10079679
210 Ga0105237_10090631
211 Ga0105237_10163587
212 Ga0105237_10178460
213 Ga0105238_10022061
214 Ga0105238_10078333
215 Ga0105249_10031815
216 Ga0105239_10456461
217 Ga0213873_10000033
218 Ga0213876_10004164
219 Ga0213876_10011812
220 Ga0213876_10074420
221 Ga0213875_10000881
222 Ga0213875_10051269
223 Ga0209566_100054
224 Ga0207684_10000298
225 Ga0207684_10004685
226 Ga0207695_10126206
227 Ga0207671_10056673
228 Ga0207693_10011048
229 Ga0207693_10105230
230 Ga0207693_10192824
231 Ga0207663_10103318
232 Ga0207646_10003916
233 Ga0207681_10077593
234 Ga0207700_10042643
235 Ga0207700_10166855
236 Ga0207664_10029842
237 Ga0207712_10017497
238 Ga0207712_10075550
239 Ga0207639_10088269
240 Ga0265337_1001491
241 Ga0265326_10000845
242 Ga0265319_1001683
243 Ga0265334_10000121
244 Ga0265323_10001684
245 Ga0265322_10030588
246 Ga0265336_10001936
247 Ga0265338_10000059
248 Ga0265338_10027480
249 Ga0265324_10004673
250 Ga0307511_10000324
251 Ga0265332_10004871
252 Ga0265320_10005653
253 Ga0265325_10002259
254 Ga0265340_10006472
255 Ga0265316_10020883
256 Ga0307408_100071268
257 Ga0265313_10004322
258 Ga0265314_10013406
259 Ga0307405_10001195
260 Ga0307410_10014901
261 Ga0307406_10009320
262 Ga0307412_10051973
263 Ga0307412_10071045
264 Ga0307409_100010943
265 Ga0307416_100000750
266 Ga0307411_10004850
267 Ga0307415_100001242
268 Ga0307415_100003829
269 Ga0307415_100036275
270 Ga0373933_0005145
271 Ga0373933_0051643
272 Ga0373925_0009041
273 Ga0395900_0211597
274 Ga0395898_0301003
275 Ga0436364_0425205
276 Ga0436364_0648810
277 Ga0436364_1118079
278 Ga0436364_1501980
279 Ga0436364_1554164
280 Ga0436365_0034724
281 Ga0436365_0589592
282 Ga0436365_0995223
283 Ga0436365_1036137
284 Ga0436365_1287264
285 Ga0436362_0551347
286 Ga0466969_0002301
287 Ga0466969_0012020
288 Ga0466969_0077905
289 Ga0466972_0009052
290 Ga0466972_0027272
291 Ga0466972_0070215
292 Ga0466966_0000466
293 Ga0466966_0004002
294 Ga0466966_0100284
295 Ga0466961_0001382
296 Ga0466961_0044870
297 Ga0466961_0065493
298 Ga0466963_0006864
299 Ga0466968_0017805
300 Ga0466968_0052885
301 Ga0466970_0009054
302 Ga0466970_0031996
303 Ga0466970_0035270
304 Ga0466957_0075174
305 Ga0466960_0059249
306 Ga0466959_0000691
307 Ga0466959_0001964
308 Ga0466959_0051785
309 Ga0466959_0100755
310 Ga0466959_0137288
311 Ga0466967_0050330
312 Ga0466967_0217704
313 Ga0495650_0040900
314 Ga0495585_0100799
315 Ga0495606_0001048
316 Ga0495631_0116897
317 Ga0495668_0000246
318 Ga0495625_0002894
319 Ga0495636_0005664
320 Ga0495626_0000124
321 Ga0496101_0010931
322 Ga0496106_0014308
323 Ga0496108_0000379
324 Ga0496119_0028886
325 Ga0496126_0012943
326 Ga0501067_0098610
327 Ga0501072_0008427
328 Ga0501072_0021714
329 Ga0501075_0265428
330 Ga0501076_0105257
331 Ga0501080_0261861
332 Ga0501083_0008233
333 nmdc:mga05p37_41098_c1
334 nmdc:mga0qj67_9937_c1
335 nmdc:mga06r32_5688_c1
336 nmdc:mga0n895_47623_c1
337 nmdc:mga0a205_3577_c1
338 Ga0500646_0000403
339 Ga0466962_0018926
340 2512733767
341 2515855018
342 2559429884
343 2559431597
344 2616906254
345 2673168551
346 2816511384
347 2819567038
348 2887480813
349 2912715323
350 2936366528
351 3006500427
352 8008575240

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00067

p450

Cytochrome P450

117

443

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l94-assembly2.cif.gz_B the 2.25 a crystal structure of cyp109e1 from bacillus megaterium in complex with testosterone 0.956 30 413
5l94-assembly2.cif.gz_B the 2.25 a crystal structure of cyp109e1 from bacillus megaterium in complex with testosterone 0.9456 30 413
5l92-assembly2.cif.gz_B the 2.1 a crystal structure of cyp109e1 from bacillus megaterium in complex with corticosterone 0.9433 26 413
3ejd-assembly4.cif.gz_H crystal structure of p450bioi in complex with hexadec-9z-enoic acid ligated acyl carrier protein 0.941 24 413
3eje-assembly1.cif.gz_B crystal structure of p450bioi in complex with octadec-9z-enoic acid ligated acyl carrier protein 0.9408 26 414
ID Description Score Start End Superfamily
5l92B00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9433 26 413 1.10.630.10
5l92B00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9334 26 413 1.10.630.10
3ejbD02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9301 91 414 1.10.630.10
5ofqD00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9249 15 414 1.10.630.10
4rm4A00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9243 30 413 1.10.630.10
ID Description Score Start End GO Terms
AF-A0A4Q3SS38-F1-model_v4 Cytochrome P450 0.9697 247 412 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A534PBB6-F1-model_v4 Cytochrome P450 0.9601 240 413 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A535GC31-F1-model_v4 Cytochrome P450 0.9598 255 414 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A4Q3SS38-F1-model_v4 Cytochrome P450 0.9584 247 412 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A2D4WK97-F1-model_v4 Cytochrome P450 0.9576 130 415 GO:0004497
GO:0005506
GO:0016705
GO:0020037

Map