F267837

General Info

Members Datasets Scaffolds Average Seq Length
176 122 352 285

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100012885|Ga0070678_1000128853
Length 314
Sequence MALCDDRMTNSFQPAVNPSVVQSQAVREPGRAHVLVIGNEKGGSGKSTTALHIAVALMSDGARVATVDLDARQGTLTRYVENRAAFIKRKAVDLPMPVHAAVPVSGDAADEKARFEAALEPAVLGADFVVIDTPGSDTHLSRLAHTWADTLLTPLNDSFIDLDLLARVDPETLKIVRPSVYAEAVWKQRQVRSMQGARPVDWIVMRNRLSSLAARNKRDMGMVIEALAKRIGFRVAAGLSERVIYRELFLNGLTLLDLKRGSGGVGPSLTMSHVAARQEVRDLVASLNLPPPDAAAPSAVPATAAATQDLPAAG

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
37 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
38 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
40 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
42 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
60 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
61 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
62 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
65 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
73 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
76 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
77 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
78 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
86 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
87 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
88 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
89 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
90 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
93 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
94 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
95 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
96 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
97 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
98 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
99 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
100 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
101 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
102 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
103 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
104 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
105 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
106 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
107 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
108 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
109 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
110 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
111 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
112 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
113 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
114 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
115 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
116 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
117 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
118 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
119 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
120 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
121 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
122 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 0
Isolates 6.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.32
Nodule 0.57
Rhizoplane 0.57
Rhizosphere 74.43
Stem 0
Stem Tuber 0.57
Unclassified 1.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100012885 3300005456 Bacteria 5218
2 JGI25153J46596_10000048 3300003215 Bacteria 141500
3 rootH2_10006294 3300003320 Bacteria 34676
4 Ga0055531_10012285 3300003794 Bacteria 4041
5 Ga0070658_10003031 3300005327 Bacteria 13897
6 Ga0070680_100000552 3300005336 Bacteria 25632
7 Ga0070675_100112556 3300005354 Bacteria 2305
8 Ga0070667_100036936 3300005367 Bacteria 4096
9 Ga0070681_10002745 3300005458 Bacteria 16228
10 Ga0070681_10158027 3300005458 Bacteria 2191
11 Ga0070706_100343909 3300005467 Bacteria 1391
12 Ga0070698_100021216 3300005471 Bacteria 6806
13 Ga0070679_100226704 3300005530 Bacteria 1828
14 Ga0070697_100490432 3300005536 Bacteria 1074
15 Ga0068853_100173707 3300005539 Bacteria 1951
16 Ga0070686_100043982 3300005544 Bacteria 2804
17 Ga0070665_100004497 3300005548 Bacteria 14632
18 Ga0070665_100057388 3300005548 Bacteria 3902
19 Ga0068855_100075450 3300005563 Bacteria 3915
20 Ga0068855_100271494 3300005563 Bacteria 1886
21 Ga0068857_100100744 3300005577 Bacteria 2591
22 Ga0068859_100681978 3300005617 Bacteria 1119
23 Ga0068862_100037023 3300005844 Bacteria 4135
24 Ga0081455_10000863 3300005937 Bacteria 39072
25 Ga0081455_10002441 3300005937 Bacteria 22171
26 Ga0081455_10011054 3300005937 Bacteria 9089
27 Ga0081455_10096933 3300005937 Bacteria 2377
28 Ga0081539_10061326 3300005985 Bacteria 2061
29 Ga0075362_10064770 3300006177 Bacteria 1659
30 Ga0075362_10129886 3300006177 Bacteria 1197
31 Ga0075369_10007621 3300006186 Bacteria 4135
32 Ga0075366_10039055 3300006195 Bacteria 2804
33 Ga0097620_100682109 3300006931 Bacteria 1119
34 Ga0105240_10043147 3300009093 Bacteria 5742
35 Ga0105240_10122599 3300009093 Bacteria 3128
36 Ga0105240_10149152 3300009093 Bacteria 2787
37 Ga0105240_10245728 3300009093 Bacteria 2072
38 Ga0105240_10401760 3300009093 Bacteria 1543
39 Ga0105241_10374811 3300009174 Bacteria 1242
40 Ga0105237_10074392 3300009545 Bacteria 3389
41 Ga0105237_10206087 3300009545 Bacteria 1967
42 Ga0105238_10027339 3300009551 Bacteria 5812
43 Ga0105239_10053683 3300010375 Bacteria 4420
44 Ga0157370_10026807 3300013104 Bacteria 5684
45 Ga0157369_10137477 3300013105 Bacteria 2586
46 Ga0157369_10143388 3300013105 Bacteria 2527
47 Ga0157372_10468749 3300013307 Bacteria 1468
48 Ga0157376_10419040 3300014969 Bacteria 1299
49 Ga0213872_10027976 3300021361 Bacteria 2587
50 Ga0213871_10011121 3300021441 Bacteria 2059
51 Ga0209676_1000092 3300025292 Bacteria 250453
52 Ga0209758_1000048 3300025297 Bacteria 358400
53 Ga0209758_1034626 3300025297 Bacteria 2005
54 Ga0209050_1021081 3300025298 Bacteria 2393
55 Ga0207426_1032729 3300025302 Bacteria 1683
56 Ga0209257_1000237 3300025304 Bacteria 128812
57 Ga0207707_10019555 3300025912 Bacteria 5912
58 Ga0207707_10258394 3300025912 Bacteria 1512
59 Ga0207695_10060815 3300025913 Bacteria 3907
60 Ga0207695_10152609 3300025913 Bacteria 2248
61 Ga0207695_10288862 3300025913 Bacteria 1532
62 Ga0207671_10300164 3300025914 Unclassified 1269
63 Ga0207657_10329500 3300025919 Bacteria 1206
64 Ga0207652_10012974 3300025921 Bacteria 6742
65 Ga0207694_10023293 3300025924 Bacteria 4701
66 Ga0207694_10271561 3300025924 Bacteria 1391
67 Ga0207690_10198346 3300025932 Bacteria 1522
68 Ga0207670_10074859 3300025936 Bacteria 2352
69 Ga0207669_10149223 3300025937 Bacteria 1635
70 Ga0207667_10336023 3300025949 Bacteria 1542
71 Ga0207658_10092876 3300025986 Bacteria 2345
72 Ga0207702_10081583 3300026078 Bacteria 2809
73 Ga0207702_10096838 3300026078 Bacteria 2596
74 Ga0207674_10090199 3300026116 Bacteria 3057
75 Ga0207683_10022657 3300026121 Bacteria 5394
76 Ga0268266_10005477 3300028379 Bacteria 11822
77 Ga0268266_10074013 3300028379 Bacteria 2957
78 Ga0268266_10132191 3300028379 Bacteria 2233
79 Ga0268266_10176347 3300028379 Bacteria 1943
80 Ga0268265_10004776 3300028380 Bacteria 9343
81 Ga0307517_10105037 3300028786 Bacteria 2195
82 Ga0307513_10319881 3300031456 Bacteria 1310
83 Ga0307508_10068984 3300031616 Bacteria 3106
84 Ga0307516_10117008 3300031730 Bacteria 2460
85 Ga0307412_10276316 3300031911 Bacteria 1317
86 Ga0373927_0112643 3300035695 Bacteria 1773
87 Ga0373933_0172504 3300035724 Bacteria 1377
88 Ga0373937_0114928 3300036401 Bacteria 2505
89 Ga0395899_0015441 3300037312 Bacteria 5822
90 Ga0395899_0017935 3300037312 Bacteria 5386
91 Ga0395899_0100466 3300037312 Bacteria 2089
92 Ga0395899_0171255 3300037312 Bacteria 1529
93 Ga0395899_0279087 3300037312 Bacteria 1137
94 Ga0395900_0018925 3300037418 Bacteria 7023
95 Ga0395900_0025032 3300037418 Bacteria 6109
96 Ga0395900_0169895 3300037418 Bacteria 2220
97 Ga0395898_0084986 3300037466 Bacteria 3050
98 Ga0395905_0189304 3300037471 Bacteria 1931
99 Ga0395901_0006241 3300038443 Bacteria 12081
100 Ga0395901_0011532 3300038443 Bacteria 8955
101 Ga0395901_0070555 3300038443 Bacteria 3640
102 Ga0395901_0374126 3300038443 Bacteria 1467
103 Ga0436360_0603279 3300039438 Bacteria 16040
104 Ga0436361_0840269 3300039447 Bacteria 2966
105 Ga0451576_0001111 3300045051 Bacteria 49021
106 Ga0466958_0086205 3300045836 Bacteria 1938
107 Ga0495686_0100301 3300047472 Bacteria 1747
108 Ga0496112_0449677 3300048915 Bacteria 1226
109 Ga0501032_0179740 3300049569 Bacteria 1385
110 Ga0501032_0301550 3300049569 Bacteria 1036
111 Ga0501033_0095514 3300049570 Bacteria 2173
112 Ga0501034_0000125 3300049571 Bacteria 142404
113 Ga0501034_0001400 3300049571 Bacteria 32439
114 Ga0501034_0025133 3300049571 Bacteria 6062
115 Ga0501034_0226137 3300049571 Bacteria 1822
116 Ga0501037_0126424 3300049573 Bacteria 1835
117 Ga0501038_0172811 3300049574 Bacteria 1748
118 Ga0501043_0018489 3300049579 Bacteria 5467
119 Ga0501043_0086131 3300049579 Bacteria 2469
120 Ga0501047_0006318 3300049581 Bacteria 11146
121 Ga0501047_0104074 3300049581 Bacteria 2719
122 Ga0501047_0125588 3300049581 Bacteria 2446
123 Ga0501068_0013100 3300049584 Bacteria 4713
124 Ga0501070_0204081 3300049586 Bacteria 1623
125 Ga0501070_0465290 3300049586 Bacteria 1018
126 Ga0501073_0035635 3300049589 Bacteria 3535
127 Ga0501073_0062634 3300049589 Bacteria 2594
128 Ga0501073_0109093 3300049589 Bacteria 1920
129 Ga0501073_0297559 3300049589 Bacteria 1113
130 Ga0501076_0159052 3300049592 Bacteria 1840
131 Ga0501080_0040346 3300049742 Bacteria 4354
132 Ga0501080_0042308 3300049742 Bacteria 4242
133 Ga0501080_0211877 3300049742 Bacteria 1775
134 Ga0501083_0013715 3300049744 Bacteria 5669
135 Ga0501083_0034052 3300049744 Bacteria 3484
136 Ga0501083_0160645 3300049744 Bacteria 1470
137 Ga0501044_0002801 3300049823 Bacteria 19865
138 Ga0501044_0034636 3300049823 Bacteria 5294
139 Ga0501044_0104195 3300049823 Bacteria 2851
140 Ga0501044_0243781 3300049823 Bacteria 1740
141 nmdc:mga0k408_101140_c1 3300050493 Bacteria 1307
142 nmdc:mga06z11_122700_c1 3300050494 Bacteria 1451
143 nmdc:mga06z11_207908_c1 3300050494 Bacteria 1139
144 nmdc:mga0sz30_194505_c1 3300050516 Bacteria 900
145 Ga0500644_0130434 3300053088 Bacteria 989
146 Ga0500647_0078761 3300053091 Bacteria 1581
147 Ga0500641_0001597 3300053096 Bacteria 8068
148 Ga0500641_0006124 3300053096 Bacteria 4262
149 Ga0500555_004800 3300053103 Bacteria 3836
150 Ga0500595_000648 3300053119 Bacteria 20943
151 Ga0500595_020523 3300053119 Bacteria 2376
152 Ga0500614_043129 3300053123 Bacteria 1155
153 Ga0500658_0032167 3300053134 Bacteria 2056
154 Ga0500559_0026342 3300053136 Bacteria 2476
155 Ga0500568_0062129 3300053139 Bacteria 1443
156 Ga0500588_0000707 3300053146 Bacteria 5652
157 Ga0500604_0008188 3300053151 Bacteria 2771
158 Ga0500604_0011426 3300053151 Bacteria 2384
159 Ga0500616_0001528 3300053153 Bacteria 21786
160 Ga0500645_072749 3300053730 Unclassified 986
161 Ga0500609_001027 3300053731 Bacteria 4182
162 Ga0500552_000040 3300053733 Bacteria 10968
163 Ga0501084_0012479 3300054114 Bacteria 7040
164 Ga0501082_0004011 3300060353 Bacteria 12849
165 Ga0501082_0069925 3300060353 Bacteria 3023
166 2715501893 2713897090 Bacteria 3353799
167 2834579080 2834578030 Bacteria 3530182
168 2854685142 2854681122 Bacteria 4548679
169 2855022696 2855020534 Bacteria 3204685
170 2898796905 2898795034 Bacteria 4294459
171 2899259972 2899259804 Bacteria 3320927
172 2899276194 2899275550 Bacteria 3958688
173 2919679466 2919679072 Bacteria 4629602
174 3000019801 3000017691 Bacteria 3772574
175 3000406693 3000405567 Bacteria 3779330
176 8057134974 8057132660 Bacteria 4061191
177 Ga0070678_100012885
178 JGI25153J46596_10000048
179 rootH2_10006294
180 Ga0055531_10012285
181 Ga0070658_10003031
182 Ga0070680_100000552
183 Ga0070675_100112556
184 Ga0070667_100036936
185 Ga0070681_10002745
186 Ga0070681_10158027
187 Ga0070706_100343909
188 Ga0070698_100021216
189 Ga0070679_100226704
190 Ga0070697_100490432
191 Ga0068853_100173707
192 Ga0070686_100043982
193 Ga0070665_100004497
194 Ga0070665_100057388
195 Ga0068855_100075450
196 Ga0068855_100271494
197 Ga0068857_100100744
198 Ga0068859_100681978
199 Ga0068862_100037023
200 Ga0081455_10000863
201 Ga0081455_10002441
202 Ga0081455_10011054
203 Ga0081455_10096933
204 Ga0081539_10061326
205 Ga0075362_10064770
206 Ga0075362_10129886
207 Ga0075369_10007621
208 Ga0075366_10039055
209 Ga0097620_100682109
210 Ga0105240_10043147
211 Ga0105240_10122599
212 Ga0105240_10149152
213 Ga0105240_10245728
214 Ga0105240_10401760
215 Ga0105241_10374811
216 Ga0105237_10074392
217 Ga0105237_10206087
218 Ga0105238_10027339
219 Ga0105239_10053683
220 Ga0157370_10026807
221 Ga0157369_10137477
222 Ga0157369_10143388
223 Ga0157372_10468749
224 Ga0157376_10419040
225 Ga0213872_10027976
226 Ga0213871_10011121
227 Ga0209676_1000092
228 Ga0209758_1000048
229 Ga0209758_1034626
230 Ga0209050_1021081
231 Ga0207426_1032729
232 Ga0209257_1000237
233 Ga0207707_10019555
234 Ga0207707_10258394
235 Ga0207695_10060815
236 Ga0207695_10152609
237 Ga0207695_10288862
238 Ga0207671_10300164
239 Ga0207657_10329500
240 Ga0207652_10012974
241 Ga0207694_10023293
242 Ga0207694_10271561
243 Ga0207690_10198346
244 Ga0207670_10074859
245 Ga0207669_10149223
246 Ga0207667_10336023
247 Ga0207658_10092876
248 Ga0207702_10081583
249 Ga0207702_10096838
250 Ga0207674_10090199
251 Ga0207683_10022657
252 Ga0268266_10005477
253 Ga0268266_10074013
254 Ga0268266_10132191
255 Ga0268266_10176347
256 Ga0268265_10004776
257 Ga0307517_10105037
258 Ga0307513_10319881
259 Ga0307508_10068984
260 Ga0307516_10117008
261 Ga0307412_10276316
262 Ga0373927_0112643
263 Ga0373933_0172504
264 Ga0373937_0114928
265 Ga0395899_0015441
266 Ga0395899_0017935
267 Ga0395899_0100466
268 Ga0395899_0171255
269 Ga0395899_0279087
270 Ga0395900_0018925
271 Ga0395900_0025032
272 Ga0395900_0169895
273 Ga0395898_0084986
274 Ga0395905_0189304
275 Ga0395901_0006241
276 Ga0395901_0011532
277 Ga0395901_0070555
278 Ga0395901_0374126
279 Ga0436360_0603279
280 Ga0436361_0840269
281 Ga0451576_0001111
282 Ga0466958_0086205
283 Ga0495686_0100301
284 Ga0496112_0449677
285 Ga0501032_0179740
286 Ga0501032_0301550
287 Ga0501033_0095514
288 Ga0501034_0000125
289 Ga0501034_0001400
290 Ga0501034_0025133
291 Ga0501034_0226137
292 Ga0501037_0126424
293 Ga0501038_0172811
294 Ga0501043_0018489
295 Ga0501043_0086131
296 Ga0501047_0006318
297 Ga0501047_0104074
298 Ga0501047_0125588
299 Ga0501068_0013100
300 Ga0501070_0204081
301 Ga0501070_0465290
302 Ga0501073_0035635
303 Ga0501073_0062634
304 Ga0501073_0109093
305 Ga0501073_0297559
306 Ga0501076_0159052
307 Ga0501080_0040346
308 Ga0501080_0042308
309 Ga0501080_0211877
310 Ga0501083_0013715
311 Ga0501083_0034052
312 Ga0501083_0160645
313 Ga0501044_0002801
314 Ga0501044_0034636
315 Ga0501044_0104195
316 Ga0501044_0243781
317 nmdc:mga0k408_101140_c1
318 nmdc:mga06z11_122700_c1
319 nmdc:mga06z11_207908_c1
320 nmdc:mga0sz30_194505_c1
321 Ga0500644_0130434
322 Ga0500647_0078761
323 Ga0500641_0001597
324 Ga0500641_0006124
325 Ga0500555_004800
326 Ga0500595_000648
327 Ga0500595_020523
328 Ga0500614_043129
329 Ga0500658_0032167
330 Ga0500559_0026342
331 Ga0500568_0062129
332 Ga0500588_0000707
333 Ga0500604_0008188
334 Ga0500604_0011426
335 Ga0500616_0001528
336 Ga0500645_072749
337 Ga0500609_001027
338 Ga0500552_000040
339 Ga0501084_0012479
340 Ga0501082_0004011
341 Ga0501082_0069925
342 2715501893
343 2834579080
344 2854685142
345 2855022696
346 2898796905
347 2899259972
348 2899276194
349 2919679466
350 3000019801
351 3000406693
352 8057134974

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09140

MipZ

ATPase MipZ

33

291

0.96

PF13614

AAA_31

AAA domain

32

100

0.85

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

31

105

0.82

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

35

255

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xj4-assembly1.cif.gz_A structure of the bacterial cell division regulator protein mipz 0.9051 24 283
2xj9-assembly1.cif.gz_A dimer structure of the bacterial cell division regulator mipz 0.9017 22 283
2xj9-assembly1.cif.gz_B dimer structure of the bacterial cell division regulator mipz 0.8957 22 283
2xj9-assembly1.cif.gz_A dimer structure of the bacterial cell division regulator mipz 0.8854 22 283
2xit-assembly1.cif.gz_A crystal structure of monomeric mipz 0.8792 21 283
ID Description Score Start End Superfamily
2xitB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8765 24 283 3.40.50.300
2xitB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.818 24 283 3.40.50.300
3cwqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.747 25 282 3.40.50.300
3cwqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7235 25 282 3.40.50.300
4e07A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.699 24 282 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6J4FX94-F1-model_v4 ATPase 0.9769 18 284
AF-A0A109K472-F1-model_v4 ATPase 0.9691 22 126
AF-A0A2A5EVV7-F1-model_v4 ATPase 0.9667 28 284
AF-A0A1Y5SK17-F1-model_v4 ATPase MipZ 0.9642 22 292
AF-A0A2N3PWL2-F1-model_v4 ATPase 0.9598 18 281

Map