F267195

General Info

Members Datasets Scaffolds Average Seq Length
175 146 350 134

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_900592_c1|nmdc:mga0yw44_900592_c1_140_586
Length 148
Sequence MRVDGAQERETGTMAITYANPSGLPEIDVYRQVSIASGSKLVFIAGQVAWDAEGVTIGEGDLAAQVEQSYLNVGIALAEVGGSFDDVAKLTFYVVDWTPDKMPALLEGISRAAAKLGTTPAPPATLIGVAALDVPEHLVEIEATAVLD

Samples

Sample ID Description Type Environment
1 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
31 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
32 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
42 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
44 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
45 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
46 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
47 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
48 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
49 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
50 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
51 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
52 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
61 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
62 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
63 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
64 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
65 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
66 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
67 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
68 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
69 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
70 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
71 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
72 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
73 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
79 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
80 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
81 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
87 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
94 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
95 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
96 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
99 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
103 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
104 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
105 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
106 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
107 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
108 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
109 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
110 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
111 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
112 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
113 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
114 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
115 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
116 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
117 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
118 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
119 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
120 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
121 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
122 2867428634 Streptomyces sp. RP5T Isolate Unclassified
123 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
124 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
125 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
126 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
127 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
128 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
129 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
130 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
131 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
132 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
133 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
134 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
135 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
136 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
137 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
138 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
139 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
140 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
141 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
142 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
143 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
144 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
145 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
146 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.43
Metatranscriptomes 0
Isolates 20.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16
Nodule 1.14
Rhizoplane 5.14
Rhizosphere 62.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0yw44_900592_c1 3300050492 Bacteria 600
2 JGI24739J22299_10023268 3300001989 Bacteria 2191
3 JGI24737J22298_10113198 3300001990 Bacteria 802
4 JGI24735J21928_10040540 3300002067 Bacteria 1359
5 JGI24735J21928_10044462 3300002067 Bacteria 1290
6 rootH1_10100209 3300003316 Bacteria 2434
7 rootL2_10124993 3300003322 Bacteria 2187
8 rootH1_10021549 3300003323 Bacteria 2339
9 rootH1_10183427 3300003323 Bacteria 1082
10 JGI25160J50197_1001565 3300003354 Bacteria 11282
11 Ga0070668_100000713 3300005347 Bacteria 22758
12 Ga0070667_100415456 3300005367 Bacteria 1226
13 Ga0070667_100927469 3300005367 Bacteria 811
14 Ga0070714_100645312 3300005435 Bacteria 1019
15 Ga0070710_10000130 3300005437 Bacteria 34963
16 Ga0070700_100156938 3300005441 Bacteria 1562
17 Ga0070663_100000112 3300005455 Bacteria 37777
18 Ga0070706_101710503 3300005467 Bacteria 573
19 Ga0068861_100160706 3300005719 Bacteria 1853
20 Ga0068860_100132264 3300005843 Bacteria 2395
21 Ga0075365_10000178 3300006038 Bacteria 20641
22 Ga0075365_10108099 3300006038 Bacteria 1910
23 Ga0075368_10002327 3300006042 Bacteria 6171
24 Ga0075368_10003389 3300006042 Bacteria 5318
25 Ga0075363_100005055 3300006048 Bacteria 5833
26 Ga0075363_100014423 3300006048 Bacteria 3861
27 Ga0075362_10005344 3300006177 Bacteria 4693
28 Ga0075367_10002489 3300006178 Bacteria 8440
29 Ga0075367_10006654 3300006178 Bacteria 5859
30 Ga0075367_10619107 3300006178 Bacteria 688
31 Ga0075370_10134079 3300006353 Bacteria 1446
32 Ga0105241_12154109 3300009174 Bacteria 552
33 Ga0105246_10004056 3300011119 Bacteria 8898
34 Ga0157372_10122034 3300013307 Bacteria 2994
35 Ga0157375_10515534 3300013308 Bacteria 1359
36 Ga0182008_10026053 3300014497 Bacteria 2966
37 Ga0157379_10582902 3300014968 Bacteria 1043
38 Ga0182006_1021005 3300015261 Bacteria 2728
39 Ga0207426_1000300 3300025302 Bacteria 96857
40 Ga0207426_1107829 3300025302 Bacteria 707
41 Ga0207692_10000053 3300025898 Bacteria 34210
42 Ga0207647_10041911 3300025904 Bacteria 2875
43 Ga0207691_11126083 3300025940 Bacteria 652
44 Ga0207668_10002413 3300025972 Bacteria 10926
45 Ga0207658_10038486 3300025986 Bacteria 3446
46 Ga0207658_10165466 3300025986 Bacteria 1816
47 Ga0207708_10454102 3300026075 Bacteria 1068
48 Ga0207702_10154267 3300026078 Bacteria 2092
49 Ga0207674_10542271 3300026116 Bacteria 1124
50 Ga0209371_1064727 3300027312 Bacteria 662
51 Ga0209813_10003432 3300027866 Bacteria 3708
52 Ga0268264_12013510 3300028381 Bacteria 587
53 Ga0268256_1067231 3300030500 Bacteria 701
54 Ga0314311_1062288 3300030733 Bacteria 2720
55 Ga0316178_1015339 3300030735 Bacteria 1226
56 Ga0316180_1079309 3300030736 Bacteria 1788
57 Ga0307513_10009267 3300031456 Bacteria 12462
58 Ga0307513_10225337 3300031456 Bacteria 1692
59 Ga0307509_10100355 3300031507 Bacteria 2933
60 Ga0307514_10123799 3300031649 Bacteria 1797
61 Ga0307516_10222905 3300031730 Bacteria 1594
62 Ga0307405_10052241 3300031731 Bacteria 2540
63 Ga0307518_10399091 3300031838 Bacteria 768
64 Ga0307410_11449423 3300031852 Bacteria 604
65 Ga0326468_10009779 3300031889 Bacteria 957
66 Ga0307406_10453266 3300031901 Bacteria 1030
67 Ga0307416_101379182 3300032002 Bacteria 811
68 Ga0307415_100010763 3300032126 Bacteria 5197
69 Ga0395900_0428028 3300037418 Bacteria 1283
70 Ga0395901_0194587 3300038443 Bacteria 2126
71 Ga0395901_0646957 3300038443 Bacteria 1061
72 Ga0451789_1342046 3300041443 Bacteria 865
73 Ga0451791_1633205 3300041451 Bacteria 979
74 Ga0451791_1705818 3300041451 Bacteria 579
75 Ga0451793_0812767 3300041452 Bacteria 632
76 Ga0451798_0851887 3300041458 Bacteria 552
77 Ga0451800_0056577 3300041459 Bacteria 564
78 Ga0451833_0784677 3300041491 Bacteria 1072
79 Ga0451835_0383526 3300041492 Bacteria 576
80 Ga0451835_0547402 3300041492 Bacteria 950
81 Ga0451841_1153503 3300041498 Bacteria 597
82 Ga0451853_1288363 3300041512 Bacteria 7095
83 Ga0451853_3919546 3300041512 Bacteria 2072
84 Ga0439448_0013534 3300042005 Bacteria 2452
85 Ga0439455_0001828 3300042012 Bacteria 3706
86 Ga0450902_094918 3300042137 Bacteria 528
87 Ga0439458_0001897 3300042157 Bacteria 5174
88 Ga0466969_0068783 3300044656 Bacteria 1706
89 Ga0466972_0007642 3300044658 Bacteria 5426
90 Ga0466972_0038384 3300044658 Bacteria 2340
91 Ga0466972_0053765 3300044658 Bacteria 1939
92 Ga0466972_0075690 3300044658 Bacteria 1604
93 Ga0466965_0009982 3300044683 Bacteria 4416
94 Ga0466965_0015155 3300044683 Bacteria 3660
95 Ga0466965_0077456 3300044683 Bacteria 1679
96 Ga0466966_0017786 3300044684 Bacteria 4694
97 Ga0466963_0054835 3300044694 Bacteria 2650
98 Ga0466964_0032615 3300044706 Bacteria 2070
99 Ga0466971_0063771 3300044719 Bacteria 1668
100 Ga0466968_0014548 3300044735 Bacteria 3110
101 Ga0466960_0003108 3300044901 Bacteria 6358
102 Ga0466960_0172764 3300044901 Bacteria 1167
103 Ga0466967_0110643 3300045976 Bacteria 2523
104 Ga0495592_0292033 3300046454 Bacteria 1062
105 Ga0495638_0200393 3300046460 Bacteria 1127
106 Ga0495651_0123988 3300046462 Bacteria 1894
107 Ga0495618_0344572 3300046514 Bacteria 919
108 Ga0495652_0075278 3300046529 Bacteria 2804
109 Ga0495634_0147828 3300046642 Bacteria 1488
110 Ga0495635_0664340 3300046663 Bacteria 677
111 Ga0495657_0202127 3300046675 Bacteria 1210
112 Ga0495658_0953903 3300046683 Bacteria 548
113 Ga0495613_0008959 3300046689 Bacteria 7428
114 Ga0495589_0009238 3300046794 Bacteria 5128
115 Ga0495589_0040657 3300046794 Bacteria 2321
116 Ga0495600_0063728 3300046809 Bacteria 2409
117 Ga0495636_0009893 3300047318 Bacteria 3755
118 Ga0495636_0039526 3300047318 Bacteria 1954
119 Ga0495672_0313234 3300047320 Bacteria 739
120 Ga0495672_0449590 3300047320 Bacteria 581
121 Ga0495680_0019558 3300047322 Bacteria 5712
122 Ga0495687_042064 3300047443 Bacteria 1999
123 Ga0495685_015320 3300047447 Bacteria 2613
124 Ga0495685_018434 3300047447 Bacteria 2396
125 Ga0496102_0251349 3300048905 Bacteria 1667
126 Ga0496108_0112348 3300048911 Bacteria 2331
127 nmdc:mga03n38_272600_c1 3300050490 Bacteria 901
128 nmdc:mga00v17_1624_c1 3300050491 Bacteria 11753
129 nmdc:mga0yw44_124670_c1 3300050492 Bacteria 1662
130 nmdc:mga0yw44_2909_c1 3300050492 Bacteria 7449
131 nmdc:mga06z11_102593_c1 3300050494 Bacteria 1572
132 nmdc:mga06z11_1655_c1 3300050494 Bacteria 8355
133 nmdc:mga04h51_138669_c1 3300050495 Bacteria 921
134 nmdc:mga04h51_1393_c1 3300050495 Bacteria 5580
135 nmdc:mga07m45_528064_c1 3300050496 Bacteria 683
136 Ga0500650_0317352 3300053098 Bacteria 687
137 Ga0500562_002169 3300053108 Bacteria 4906
138 Ga0500600_0145323 3300053149 Bacteria 1188
139 Ga0466962_0022558 3300061719 Bacteria 3025
140 2515498277 2515154088 Bacteria 5526283
141 2516085063 2515154202 Bacteria 5471270
142 2516088011 2515154203 Bacteria 5458536
143 2585309605 2582581313 Bacteria 10042643
144 2586060859 2585427649 Bacteria 9053857
145 2686534547 2684623035 Bacteria 8032739
146 2785373625 2784746768 Bacteria 10036182
147 2786667280 2786546132 Bacteria 10419719
148 2793980822 2791355406 Bacteria 11364898
149 2819693552 2818991463 Bacteria 7948711
150 2862384514 2862382967 Bacteria 10317375
151 2867437197 2867428634 Bacteria 9590268
152 2868095614 2868088558 Bacteria 7609351
153 2870785117 2870782633 Bacteria 9624083
154 2875396904 2875391855 Bacteria 7600475
155 2912720601 2912715099 Bacteria 9460473
156 2915769892 2915768154 Bacteria 8424322
157 2946064203 2946064051 Bacteria 8957905
158 2954682368 2954673503 Bacteria 9685905
159 2954690556 2954682443 Bacteria 9862841
160 2954691756 2954691527 Bacteria 10720516
161 2954706872 2954701450 Bacteria 10834262
162 2954718715 2954711539 Bacteria 10867210
163 2954728686 2954721474 Bacteria 10456478
164 2954733126 2954731030 Bacteria 10243860
165 2954747583 2954740390 Bacteria 10229294
166 2954752006 2954749733 Bacteria 10366972
167 2954766699 2954759201 Bacteria 9358192
168 3006497068 3006493962 Bacteria 8825450
169 8008564631 8008558824 Bacteria 10610750
170 8023630640 8023623736 Bacteria 8593882
171 8025534626 8025530807 Bacteria 8495698
172 8047902964 8047893842 Bacteria 11723082
173 8048135420 8048127548 Bacteria 11053136
174 8048370760 8048369669 Bacteria 11666822
175 8048388662 8048379754 Bacteria 11877923
176 nmdc:mga0yw44_900592_c1
177 JGI24739J22299_10023268
178 JGI24737J22298_10113198
179 JGI24735J21928_10040540
180 JGI24735J21928_10044462
181 rootH1_10100209
182 rootL2_10124993
183 rootH1_10021549
184 rootH1_10183427
185 JGI25160J50197_1001565
186 Ga0070668_100000713
187 Ga0070667_100415456
188 Ga0070667_100927469
189 Ga0070714_100645312
190 Ga0070710_10000130
191 Ga0070700_100156938
192 Ga0070663_100000112
193 Ga0070706_101710503
194 Ga0068861_100160706
195 Ga0068860_100132264
196 Ga0075365_10000178
197 Ga0075365_10108099
198 Ga0075368_10002327
199 Ga0075368_10003389
200 Ga0075363_100005055
201 Ga0075363_100014423
202 Ga0075362_10005344
203 Ga0075367_10002489
204 Ga0075367_10006654
205 Ga0075367_10619107
206 Ga0075370_10134079
207 Ga0105241_12154109
208 Ga0105246_10004056
209 Ga0157372_10122034
210 Ga0157375_10515534
211 Ga0182008_10026053
212 Ga0157379_10582902
213 Ga0182006_1021005
214 Ga0207426_1000300
215 Ga0207426_1107829
216 Ga0207692_10000053
217 Ga0207647_10041911
218 Ga0207691_11126083
219 Ga0207668_10002413
220 Ga0207658_10038486
221 Ga0207658_10165466
222 Ga0207708_10454102
223 Ga0207702_10154267
224 Ga0207674_10542271
225 Ga0209371_1064727
226 Ga0209813_10003432
227 Ga0268264_12013510
228 Ga0268256_1067231
229 Ga0314311_1062288
230 Ga0316178_1015339
231 Ga0316180_1079309
232 Ga0307513_10009267
233 Ga0307513_10225337
234 Ga0307509_10100355
235 Ga0307514_10123799
236 Ga0307516_10222905
237 Ga0307405_10052241
238 Ga0307518_10399091
239 Ga0307410_11449423
240 Ga0326468_10009779
241 Ga0307406_10453266
242 Ga0307416_101379182
243 Ga0307415_100010763
244 Ga0395900_0428028
245 Ga0395901_0194587
246 Ga0395901_0646957
247 Ga0451789_1342046
248 Ga0451791_1633205
249 Ga0451791_1705818
250 Ga0451793_0812767
251 Ga0451798_0851887
252 Ga0451800_0056577
253 Ga0451833_0784677
254 Ga0451835_0383526
255 Ga0451835_0547402
256 Ga0451841_1153503
257 Ga0451853_1288363
258 Ga0451853_3919546
259 Ga0439448_0013534
260 Ga0439455_0001828
261 Ga0450902_094918
262 Ga0439458_0001897
263 Ga0466969_0068783
264 Ga0466972_0007642
265 Ga0466972_0038384
266 Ga0466972_0053765
267 Ga0466972_0075690
268 Ga0466965_0009982
269 Ga0466965_0015155
270 Ga0466965_0077456
271 Ga0466966_0017786
272 Ga0466963_0054835
273 Ga0466964_0032615
274 Ga0466971_0063771
275 Ga0466968_0014548
276 Ga0466960_0003108
277 Ga0466960_0172764
278 Ga0466967_0110643
279 Ga0495592_0292033
280 Ga0495638_0200393
281 Ga0495651_0123988
282 Ga0495618_0344572
283 Ga0495652_0075278
284 Ga0495634_0147828
285 Ga0495635_0664340
286 Ga0495657_0202127
287 Ga0495658_0953903
288 Ga0495613_0008959
289 Ga0495589_0009238
290 Ga0495589_0040657
291 Ga0495600_0063728
292 Ga0495636_0009893
293 Ga0495636_0039526
294 Ga0495672_0313234
295 Ga0495672_0449590
296 Ga0495680_0019558
297 Ga0495687_042064
298 Ga0495685_015320
299 Ga0495685_018434
300 Ga0496102_0251349
301 Ga0496108_0112348
302 nmdc:mga03n38_272600_c1
303 nmdc:mga00v17_1624_c1
304 nmdc:mga0yw44_124670_c1
305 nmdc:mga0yw44_2909_c1
306 nmdc:mga06z11_102593_c1
307 nmdc:mga06z11_1655_c1
308 nmdc:mga04h51_138669_c1
309 nmdc:mga04h51_1393_c1
310 nmdc:mga07m45_528064_c1
311 Ga0500650_0317352
312 Ga0500562_002169
313 Ga0500600_0145323
314 Ga0466962_0022558
315 2515498277
316 2516085063
317 2516088011
318 2585309605
319 2586060859
320 2686534547
321 2785373625
322 2786667280
323 2793980822
324 2819693552
325 2862384514
326 2867437197
327 2868095614
328 2870785117
329 2875396904
330 2912720601
331 2915769892
332 2946064203
333 2954682368
334 2954690556
335 2954691756
336 2954706872
337 2954718715
338 2954728686
339 2954733126
340 2954747583
341 2954752006
342 2954766699
343 3006497068
344 8008564631
345 8023630640
346 8025534626
347 8047902964
348 8048135420
349 8048370760
350 8048388662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

23

147

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dyy-assembly3.cif.gz_G crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.8205 23 133
3l7q-assembly2.cif.gz_E crystal structure of aldr from streptococcus mutans 0.8127 24 133
1qu9-assembly1.cif.gz_A 1.2 a crystal structure of yjgf gene product from e. coli 0.8119 24 131
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.8095 26 132
7cd2-assembly5.cif.gz_R crystal structure of the s103f mutant of bacillus subtilis (natto) yabj protein. 0.8055 26 133
ID Description Score Start End Superfamily
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8231 26 132 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8205 23 133 3.30.1330.40
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8095 26 132 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.7617 26 132 3.30.1330.40
af_Q9USQ7_300_402_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.7522 22 130 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A1Q9RVB0-F1-model_v4 Enamine deaminase RidA 0.9493 41 133
AF-A0A6G2LHZ2-F1-model_v4 deleted 0.9443 50 133
AF-A0A7K2QAI4-F1-model_v4 RidA family protein 0.9359 69 133
AF-A0A1G6JWB1-F1-model_v4 Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family 0.9328 18 133 GO:0005829
GO:0019239
AF-A0A1G6JWB1-F1-model_v4 Enamine deaminase RidA, house cleaning of reactive enamine intermediates, YjgF/YER057c/UK114 family 0.9251 18 133 GO:0005829
GO:0019239

Map