F266972

General Info

Members Datasets Scaffolds Average Seq Length
175 118 351 174

Family's Representative Sequence

Representative Sequence 3300046665|Ga0495661_0155412|Ga0495661_0155412_244_819
Length 191
Sequence MPVPQTVTIQKLTLADADVLLDLSKKTFFDFFAHLNKPEDMESYSSVAFTPQKIQAELSNPNSHFFFAMLDGEIAGYLKLNYGAAQTEFQDSDAVEIERIYVLAQHHGKKIGHQFIDFTLKVAAGKKLQYVWLGVWEHNQKALAFYKKHGFEVFSSHEFVLGSDKQESGLIKLKAQSLRLKAFPRLVFFSL

Samples

Sample ID Description Type Environment
1 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
52 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
54 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
55 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
92 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
95 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
96 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
97 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
98 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
104 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
105 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
106 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
107 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
108 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
109 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
110 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
111 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
112 2738541284 Pedobacter sp. YR016 Isolate Unclassified
113 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
114 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
115 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
116 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
117 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
118 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.86
Metatranscriptomes 0.57
Isolates 4.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.29
Nodule 0
Rhizoplane 0.57
Rhizosphere 87.43
Stem 0
Stem Tuber 0
Unclassified 6.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495661_0155412 3300046665 Bacteria 1232
2 JGI24737J22298_10000734 3300001990 Bacteria 11560
3 JGI24735J21928_10000001 3300002067 Bacteria 650042
4 rootH1_10023084 3300003316 Bacteria 4116
5 rootH1_10023084 3300003323 Bacteria 1546
6 rootH1_10191815 3300003316 Bacteria 1277
7 rootH2_10005719 3300003320 Bacteria 108734
8 rootH2_10024702 3300003320 Bacteria 5917
9 rootH2_10039562 3300003320 Bacteria 6649
10 rootL2_10241027 3300003322 Bacteria 1316
11 Ga0065714_10080058 3300005288 Bacteria 2466
12 Ga0070658_10091793 3300005327 Bacteria 2503
13 Ga0068868_100046146 3300005338 Bacteria 3411
14 Ga0068868_100116471 3300005338 Bacteria 2176
15 Ga0070660_100074630 3300005339 Bacteria 2654
16 Ga0070671_100057091 3300005355 Bacteria 3248
17 Ga0070673_100009381 3300005364 Bacteria 6567
18 Ga0070659_100001402 3300005366 Bacteria 17377
19 Ga0070659_100014366 3300005366 Bacteria 5916
20 Ga0070663_100013803 3300005455 Bacteria 5168
21 Ga0070678_100014801 3300005456 Bacteria 4934
22 Ga0068867_100009676 3300005459 Bacteria 6795
23 Ga0068853_100032017 3300005539 Bacteria 4452
24 Ga0068853_100366461 3300005539 Bacteria 1343
25 Ga0070672_100036490 3300005543 Bacteria 3745
26 Ga0070693_100079126 3300005547 Bacteria 1955
27 Ga0070665_100000003 3300005548 Bacteria 811857
28 Ga0068855_100239548 3300005563 Bacteria 2028
29 Ga0068855_100602360 3300005563 Bacteria 1185
30 Ga0068855_100692076 3300005563 Bacteria 1092
31 Ga0068854_100083619 3300005578 Unclassified 2360
32 Ga0068856_100026624 3300005614 Bacteria 5639
33 Ga0068856_101064953 3300005614 Unclassified 826
34 Ga0068852_100015309 3300005616 Bacteria 5940
35 Ga0075366_10041665 3300006195 Bacteria 2719
36 Ga0075366_10352051 3300006195 Bacteria 904
37 Ga0097621_100000165 3300006237 Bacteria 41398
38 Ga0068871_100000018 3300006358 Bacteria 89690
39 Ga0068865_100003896 3300006881 Bacteria 8952
40 Ga0105244_10000343 3300009036 Bacteria 43808
41 Ga0105240_10026964 3300009093 Bacteria 7531
42 Ga0105240_10070476 3300009093 Bacteria 4325
43 Ga0105240_10123244 3300009093 Bacteria 3119
44 Ga0105245_10291272 3300009098 Unclassified 1599
45 Ga0105241_10009316 3300009174 Bacteria 7219
46 Ga0105241_10159718 3300009174 Bacteria 1852
47 Ga0105242_10083918 3300009176 Bacteria 2668
48 Ga0105237_10001043 3300009545 Bacteria 37218
49 Ga0105237_10008222 3300009545 Bacteria 11332
50 Ga0105237_10114679 3300009545 Bacteria 2687
51 Ga0105237_10114683 3300009545 Bacteria 2687
52 Ga0105237_10161805 3300009545 Bacteria 2237
53 Ga0105238_10013706 3300009551 Bacteria 8189
54 Ga0105249_11652601 3300009553 Bacteria 713
55 Ga0105239_10004349 3300010375 Bacteria 16979
56 Ga0105239_10006278 3300010375 Bacteria 13829
57 Ga0105239_10016752 3300010375 Bacteria 8101
58 Ga0105239_10922451 3300010375 Bacteria 1003
59 Ga0105239_11560789 3300010375 Bacteria 763
60 Ga0105246_10129186 3300011119 Bacteria 1884
61 Ga0157371_10003072 3300013102 Bacteria 15483
62 Ga0157371_10072120 3300013102 Bacteria 2445
63 Ga0157371_10085132 3300013102 Bacteria 2240
64 Ga0157370_10190712 3300013104 Bacteria 1902
65 Ga0157370_11165984 3300013104 Unclassified 695
66 Ga0157369_10196932 3300013105 Bacteria 2115
67 Ga0157374_10000348 3300013296 Bacteria 42744
68 Ga0157374_10033623 3300013296 Bacteria 4679
69 Ga0157378_10044282 3300013297 Bacteria 3952
70 Ga0157378_10103762 3300013297 Bacteria 2598
71 Ga0157378_10127118 3300013297 Bacteria 2355
72 Ga0163162_10000031 3300013306 Bacteria 157666
73 Ga0157372_10000017 3300013307 Bacteria 219543
74 Ga0157372_10000926 3300013307 Bacteria 31972
75 Ga0157372_10003633 3300013307 Bacteria 16598
76 Ga0157372_10252305 3300013307 Bacteria 2048
77 Ga0157372_10646140 3300013307 Unclassified 1232
78 Ga0157372_11693769 3300013307 Bacteria 727
79 Ga0157375_10690881 3300013308 Bacteria 1174
80 Ga0157377_10017332 3300014745 Bacteria 3723
81 Ga0157376_10251018 3300014969 Bacteria 1652
82 Ga0182007_10260585 3300015262 Bacteria 625
83 Ga0206351_10734164 3300020077 Bacteria 772
84 Ga0213872_10078371 3300021361 Bacteria 1485
85 Ga0209563_102040 3300025230 Bacteria 4799
86 Ga0209437_100017 3300025233 Bacteria 694471
87 Ga0209129_1004693 3300025258 Bacteria 5201
88 Ga0207655_1001003 3300025728 Bacteria 28719
89 Ga0207642_10090673 3300025899 Bacteria 1509
90 Ga0207647_10051384 3300025904 Bacteria 2548
91 Ga0207645_10000650 3300025907 Bacteria 28882
92 Ga0207705_10000015 3300025909 Bacteria 382901
93 Ga0207705_10099311 3300025909 Bacteria 2140
94 Ga0207654_10002197 3300025911 Bacteria 9992
95 Ga0207654_10004519 3300025911 Bacteria 7029
96 Ga0207654_10111606 3300025911 Bacteria 1702
97 Ga0207695_10007674 3300025913 Bacteria 13663
98 Ga0207671_10008508 3300025914 Bacteria 8691
99 Ga0207671_10014559 3300025914 Bacteria 6206
100 Ga0207671_10015411 3300025914 Bacteria 5983
101 Ga0207671_10048193 3300025914 Bacteria 3154
102 Ga0207657_10084171 3300025919 Bacteria 2666
103 Ga0207694_10093047 3300025924 Bacteria 2380
104 Ga0207644_10014403 3300025931 Bacteria 5290
105 Ga0207690_10001301 3300025932 Bacteria 15722
106 Ga0207690_10174284 3300025932 Bacteria 1614
107 Ga0207690_10516266 3300025932 Bacteria 968
108 Ga0207706_10000191 3300025933 Bacteria 68535
109 Ga0207706_10254994 3300025933 Unclassified 1532
110 Ga0207704_10000053 3300025938 Bacteria 79904
111 Ga0207667_10049157 3300025949 Bacteria 4457
112 Ga0207667_10603463 3300025949 Bacteria 1107
113 Ga0207667_10742874 3300025949 Bacteria 981
114 Ga0207651_10017166 3300025960 Bacteria 4267
115 Ga0207712_10512923 3300025961 Bacteria 1026
116 Ga0207640_10024813 3300025981 Bacteria 3622
117 Ga0207639_10018165 3300026041 Bacteria 4994
118 Ga0207639_10352491 3300026041 Bacteria 1315
119 Ga0207639_10779499 3300026041 Bacteria 890
120 Ga0207678_10025136 3300026067 Bacteria 5199
121 Ga0207702_10924480 3300026078 Unclassified 865
122 Ga0207648_10000175 3300026089 Bacteria 66839
123 Ga0207683_10024300 3300026121 Bacteria 5217
124 Ga0207698_10039342 3300026142 Bacteria 3502
125 Ga0268266_10000018 3300028379 Bacteria 569141
126 Ga0307517_10002197 3300028786 Bacteria 31568
127 Ga0265338_10020137 3300028800 Bacteria 7034
128 Ga0307414_10132524 3300032004 Bacteria 1937
129 Ga0395899_0000950 3300037312 Bacteria 27103
130 Ga0395899_0001735 3300037312 Bacteria 18132
131 Ga0395899_0141678 3300037312 Bacteria 1710
132 Ga0395900_0000014 3300037418 Bacteria 386513
133 Ga0395900_0001452 3300037418 Bacteria 28269
134 Ga0395900_0042924 3300037418 Bacteria 4659
135 Ga0395905_0000037 3300037471 Bacteria 261808
136 Ga0395905_0012462 3300037471 Bacteria 8185
137 Ga0395901_0000117 3300038443 Bacteria 105071
138 Ga0395901_0002612 3300038443 Bacteria 18236
139 Ga0436361_0521418 3300039447 Bacteria 1623
140 Ga0466961_0096711 3300044693 Bacteria 1862
141 Ga0453684_1362849 3300044712 Unclassified 737
142 Ga0466959_0180567 3300045049 Bacteria 1476
143 Ga0495627_074577 3300046453 Bacteria 988
144 Ga0495651_0596458 3300046462 Unclassified 697
145 Ga0495606_0000002 3300046507 Bacteria 554637
146 Ga0495606_0208396 3300046507 Bacteria 1109
147 Ga0495610_0006737 3300046512 Bacteria 7805
148 Ga0495610_0009071 3300046512 Bacteria 6341
149 Ga0495616_0005121 3300046513 Bacteria 8141
150 Ga0495616_0039001 3300046513 Bacteria 2435
151 Ga0495652_0217218 3300046529 Bacteria 1439
152 Ga0495609_0103908 3300046538 Bacteria 1229
153 Ga0495633_0007482 3300046558 Bacteria 6277
154 Ga0495625_0000005 3300046660 Bacteria 596135
155 Ga0495625_0041079 3300046660 Bacteria 3368
156 Ga0495661_0006995 3300046665 Bacteria 7888
157 Ga0495613_0813118 3300046689 Unclassified 609
158 Ga0495649_0000003 3300046694 Bacteria 880817
159 Ga0495686_0038149 3300047472 Bacteria 3074
160 Ga0495678_010642 3300049459 Bacteria 4455
161 Ga0501249_000005 3300049679 Bacteria 225972
162 Ga0501241_003490 3300049758 Bacteria 2969
163 nmdc:mga0k408_261149_c1 3300050493 Bacteria 1034
164 nmdc:mga0k408_724_c2 3300050493 Bacteria 17277
165 Ga0500650_0166957 3300053098 Bacteria 1013
166 Ga0500579_124264 3300053143 Unclassified 1236
167 Ga0500616_0087547 3300053153 Bacteria 1550
168 Ga0500624_006198 3300053157 Bacteria 1612
169 2599477359 2599185184 Bacteria 6430550
170 2738760770 2738541284 Bacteria 5199923
171 2889290908 2889290771 Bacteria 5530962
172 2904559629 2904555929 Bacteria 5218588
173 2919441304 2919437846 Bacteria 6199444
174 2928079276 2928078545 Bacteria 6534839
175 2928148352 2928147474 Bacteria 6512076
176 2932084141 2932082852 Bacteria 6563563
177 Ga0495661_0155412
178 JGI24737J22298_10000734
179 JGI24735J21928_10000001
180 rootH1_10023084
181 rootH1_10191815
182 rootH2_10005719
183 rootH2_10024702
184 rootH2_10039562
185 rootL2_10241027
186 Ga0065714_10080058
187 Ga0070658_10091793
188 Ga0068868_100046146
189 Ga0068868_100116471
190 Ga0070660_100074630
191 Ga0070671_100057091
192 Ga0070673_100009381
193 Ga0070659_100001402
194 Ga0070659_100014366
195 Ga0070663_100013803
196 Ga0070678_100014801
197 Ga0068867_100009676
198 Ga0068853_100032017
199 Ga0068853_100366461
200 Ga0070672_100036490
201 Ga0070693_100079126
202 Ga0070665_100000003
203 Ga0068855_100239548
204 Ga0068855_100602360
205 Ga0068855_100692076
206 Ga0068854_100083619
207 Ga0068856_100026624
208 Ga0068856_101064953
209 Ga0068852_100015309
210 Ga0075366_10041665
211 Ga0075366_10352051
212 Ga0097621_100000165
213 Ga0068871_100000018
214 Ga0068865_100003896
215 Ga0105244_10000343
216 Ga0105240_10026964
217 Ga0105240_10070476
218 Ga0105240_10123244
219 Ga0105245_10291272
220 Ga0105241_10009316
221 Ga0105241_10159718
222 Ga0105242_10083918
223 Ga0105237_10001043
224 Ga0105237_10008222
225 Ga0105237_10114679
226 Ga0105237_10114683
227 Ga0105237_10161805
228 Ga0105238_10013706
229 Ga0105249_11652601
230 Ga0105239_10004349
231 Ga0105239_10006278
232 Ga0105239_10016752
233 Ga0105239_10922451
234 Ga0105239_11560789
235 Ga0105246_10129186
236 Ga0157371_10003072
237 Ga0157371_10072120
238 Ga0157371_10085132
239 Ga0157370_10190712
240 Ga0157370_11165984
241 Ga0157369_10196932
242 Ga0157374_10000348
243 Ga0157374_10033623
244 Ga0157378_10044282
245 Ga0157378_10103762
246 Ga0157378_10127118
247 Ga0163162_10000031
248 Ga0157372_10000017
249 Ga0157372_10000926
250 Ga0157372_10003633
251 Ga0157372_10252305
252 Ga0157372_10646140
253 Ga0157372_11693769
254 Ga0157375_10690881
255 Ga0157377_10017332
256 Ga0157376_10251018
257 Ga0182007_10260585
258 Ga0206351_10734164
259 Ga0213872_10078371
260 Ga0209563_102040
261 Ga0209437_100017
262 Ga0209129_1004693
263 Ga0207655_1001003
264 Ga0207642_10090673
265 Ga0207647_10051384
266 Ga0207645_10000650
267 Ga0207705_10000015
268 Ga0207705_10099311
269 Ga0207654_10002197
270 Ga0207654_10004519
271 Ga0207654_10111606
272 Ga0207695_10007674
273 Ga0207671_10008508
274 Ga0207671_10014559
275 Ga0207671_10015411
276 Ga0207671_10048193
277 Ga0207657_10084171
278 Ga0207694_10093047
279 Ga0207644_10014403
280 Ga0207690_10001301
281 Ga0207690_10174284
282 Ga0207690_10516266
283 Ga0207706_10000191
284 Ga0207706_10254994
285 Ga0207704_10000053
286 Ga0207667_10049157
287 Ga0207667_10603463
288 Ga0207667_10742874
289 Ga0207651_10017166
290 Ga0207712_10512923
291 Ga0207640_10024813
292 Ga0207639_10018165
293 Ga0207639_10352491
294 Ga0207639_10779499
295 Ga0207678_10025136
296 Ga0207702_10924480
297 Ga0207648_10000175
298 Ga0207683_10024300
299 Ga0207698_10039342
300 Ga0268266_10000018
301 Ga0307517_10002197
302 Ga0265338_10020137
303 Ga0307414_10132524
304 Ga0395899_0000950
305 Ga0395899_0001735
306 Ga0395899_0141678
307 Ga0395900_0000014
308 Ga0395900_0001452
309 Ga0395900_0042924
310 Ga0395905_0000037
311 Ga0395905_0012462
312 Ga0395901_0000117
313 Ga0395901_0002612
314 Ga0436361_0521418
315 Ga0466961_0096711
316 Ga0453684_1362849
317 Ga0466959_0180567
318 Ga0495627_074577
319 Ga0495651_0596458
320 Ga0495606_0000002
321 Ga0495606_0208396
322 Ga0495610_0006737
323 Ga0495610_0009071
324 Ga0495616_0005121
325 Ga0495616_0039001
326 Ga0495652_0217218
327 Ga0495609_0103908
328 Ga0495633_0007482
329 Ga0495625_0000005
330 Ga0495625_0041079
331 Ga0495661_0006995
332 Ga0495613_0813118
333 Ga0495649_0000003
334 Ga0495686_0038149
335 Ga0495678_010642
336 Ga0501249_000005
337 Ga0501241_003490
338 nmdc:mga0k408_261149_c1
339 nmdc:mga0k408_724_c2
340 Ga0500650_0166957
341 Ga0500579_124264
342 Ga0500616_0087547
343 Ga0500624_006198
344 2599477359
345 2738760770
346 2889290908
347 2904559629
348 2919441304
349 2928079276
350 2928148352
351 2932084141

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

33

164

0.87

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

24

151

0.86

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

61

153

0.81

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

9

161

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
8osp-assembly2.cif.gz_C gcn5-related n-acetyltransferase from lactobacillus curiae 0.9821 5 174
1tiq-assembly1.cif.gz_A crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.9567 6 176
8osp-assembly2.cif.gz_C gcn5-related n-acetyltransferase from lactobacillus curiae 0.9544 5 174
1tiq-assembly2.cif.gz_B crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.9466 6 180
1tiq-assembly2.cif.gz_B crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.9411 6 180
ID Description Score Start End Superfamily
af_Q2FVQ1_4_171_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9491 8 174 3.40.630.30
1tiqB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9463 6 180 3.40.630.30
1tiqB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9407 6 180 3.40.630.30
af_Q2FVQ1_4_171_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9382 8 174 3.40.630.30
af_Q55G01_1_189_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9162 6 175 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A563U5G7-F1-model_v4 GNAT family N-acetyltransferase 0.9887 6 176 GO:0016747
AF-A0A1Q3GM64-F1-model_v4 N-acetyltransferase domain-containing protein 0.982 6 174 GO:0016747
AF-A0A327R2W1-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9819 5 174 GO:0016747
AF-A0A563U5G7-F1-model_v4 GNAT family N-acetyltransferase 0.9774 6 176 GO:0016747
AF-A0A1X7LDT9-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9764 73 174 GO:0016747

Map