F266783

General Info

Members Datasets Scaffolds Average Seq Length
175 119 350 96

Family's Representative Sequence

Representative Sequence 3300042011|Ga0439454_003326|Ga0439454_003326_163_516
Length 117
Sequence LIHIPWRGILRQREGIFREAAMATQARGYTATKKELLARLARIEGQVRGVARMVEEDRYCIDVVTQINAAGAALDKVGLGLLDGHVRHCLMGGHGGPSDPDEQAEELMGAVGRMVSR

Samples

Sample ID Description Type Environment
1 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
2 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
11 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
43 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
44 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
45 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
46 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
47 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
48 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
49 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
50 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
51 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
52 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
59 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
60 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
61 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
62 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
63 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
66 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
69 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
72 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
73 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
74 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
75 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
76 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
77 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
78 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
79 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
80 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
81 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
82 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
83 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
84 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
85 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
86 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
87 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
99 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
100 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
101 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
104 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
105 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
109 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
110 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
111 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
112 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
115 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
116 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
117 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
119 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.29
Nodule 0
Rhizoplane 1.71
Rhizosphere 93.14
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439454_003326 3300042011 Bacteria 1781
2 Ga0070687_101177677 3300005343 Bacteria 564
3 Ga0070714_100066279 3300005435 Bacteria 3112
4 Ga0070713_101744786 3300005436 Bacteria 604
5 Ga0070705_100566879 3300005440 Bacteria 873
6 Ga0070708_100024766 3300005445 Bacteria 5125
7 Ga0070708_101370738 3300005445 Bacteria 660
8 Ga0068867_101708763 3300005459 Bacteria 590
9 Ga0070707_100360038 3300005468 Bacteria 1413
10 Ga0070699_100019976 3300005518 Bacteria 5774
11 Ga0070695_100411253 3300005545 Bacteria 1028
12 Ga0070693_100314555 3300005547 Bacteria 1060
13 Ga0068855_100509249 3300005563 Bacteria 1307
14 Ga0068861_100170149 3300005719 Bacteria 1805
15 Ga0068861_101300507 3300005719 Bacteria 707
16 Ga0081455_10005858 3300005937 Bacteria 13371
17 Ga0081455_10006507 3300005937 Bacteria 12508
18 Ga0081455_10276152 3300005937 Bacteria 1216
19 Ga0081455_10366849 3300005937 Bacteria 1011
20 Ga0081539_10004965 3300005985 Bacteria 14093
21 Ga0081539_10165308 3300005985 Bacteria 1051
22 Ga0075364_10453495 3300006051 Bacteria 876
23 Ga0075432_10092478 3300006058 Bacteria 1109
24 Ga0075428_100296387 3300006844 Bacteria 1739
25 Ga0075431_100024220 3300006847 Bacteria 6217
26 Ga0075431_100283654 3300006847 Bacteria 1677
27 Ga0075433_10037733 3300006852 Bacteria 4169
28 Ga0075434_100524032 3300006871 Bacteria 1205
29 Ga0075434_101818183 3300006871 Bacteria 616
30 Ga0075436_100028199 3300006914 Bacteria 3862
31 Ga0075435_100042011 3300007076 Bacteria 3656
32 Ga0075435_100144288 3300007076 Bacteria 1999
33 Ga0111539_10011905 3300009094 Bacteria 10906
34 Ga0105245_11162058 3300009098 Bacteria 819
35 Ga0114129_10178356 3300009147 Bacteria 2892
36 Ga0114129_11158096 3300009147 Bacteria 965
37 Ga0114129_11214928 3300009147 Bacteria 938
38 Ga0114129_13193500 3300009147 Bacteria 533
39 Ga0105243_10928606 3300009148 Bacteria 868
40 Ga0105242_11932531 3300009176 Bacteria 631
41 Ga0105237_12027446 3300009545 Bacteria 584
42 Ga0105239_12353158 3300010375 Bacteria 620
43 Ga0157378_11505947 3300013297 Bacteria 717
44 Ga0157372_12710615 3300013307 Bacteria 569
45 Ga0157379_11547697 3300014968 Bacteria 646
46 Ga0207685_10395415 3300025905 Bacteria 707
47 Ga0207662_10268566 3300025918 Bacteria 1125
48 Ga0207646_11664143 3300025922 Bacteria 549
49 Ga0207687_10715655 3300025927 Bacteria 850
50 Ga0207664_10039644 3300025929 Bacteria 3658
51 Ga0207667_10850486 3300025949 Bacteria 906
52 Ga0207675_100201788 3300026118 Bacteria 1910
53 Ga0207698_11622350 3300026142 Bacteria 662
54 Ga0207428_10074504 3300027907 Bacteria 2662
55 Ga0307408_100243253 3300031548 Bacteria 1480
56 Ga0307405_10250827 3300031731 Bacteria 1317
57 Ga0307410_11829417 3300031852 Bacteria 540
58 Ga0307407_10051374 3300031903 Bacteria 2363
59 Ga0307407_11026338 3300031903 Bacteria 638
60 Ga0307412_11048122 3300031911 Bacteria 723
61 Ga0307409_100037761 3300031995 Bacteria 3564
62 Ga0307416_100040958 3300032002 Bacteria 3604
63 Ga0307416_100792793 3300032002 Unclassified 1043
64 Ga0307416_101591972 3300032002 Bacteria 758
65 Ga0307411_11413460 3300032005 Bacteria 637
66 Ga0307415_100073252 3300032126 Bacteria 2416
67 Ga0307415_101446180 3300032126 Bacteria 656
68 Ga0373937_1666461 3300036401 Bacteria 585
69 Ga0395899_0011311 3300037312 Bacteria 6834
70 Ga0395899_0070132 3300037312 Bacteria 2565
71 Ga0395899_0389835 3300037312 Bacteria 924
72 Ga0395899_0727242 3300037312 Bacteria 620
73 Ga0395899_0819469 3300037312 Bacteria 574
74 Ga0395900_0002514 3300037418 Bacteria 20130
75 Ga0395900_0007170 3300037418 Bacteria 11554
76 Ga0395900_0140985 3300037418 Bacteria 2468
77 Ga0395900_0194812 3300037418 Bacteria 2054
78 Ga0395900_0715111 3300037418 Bacteria 934
79 Ga0395900_1111070 3300037418 Bacteria 708
80 Ga0395898_0008930 3300037466 Bacteria 10558
81 Ga0395898_0281114 3300037466 Bacteria 1588
82 Ga0395898_0298394 3300037466 Bacteria 1537
83 Ga0395898_0336964 3300037466 Bacteria 1438
84 Ga0395898_0563387 3300037466 Bacteria 1082
85 Ga0395898_0704606 3300037466 Bacteria 951
86 Ga0395898_1166879 3300037466 Bacteria 702
87 Ga0395905_0003227 3300037471 Bacteria 17536
88 Ga0395905_0011340 3300037471 Bacteria 8619
89 Ga0395905_0313162 3300037471 Archaea 1458
90 Ga0395905_0811114 3300037471 Bacteria 839
91 Ga0395905_0903372 3300037471 Bacteria 786
92 Ga0395905_1779265 3300037471 Bacteria 522
93 Ga0395901_0004579 3300038443 Bacteria 13963
94 Ga0395901_0023940 3300038443 Bacteria 6264
95 Ga0395901_0067708 3300038443 Bacteria 3719
96 Ga0395901_0226450 3300038443 Bacteria 1953
97 Ga0395901_0251973 3300038443 Bacteria 1839
98 Ga0395901_0482276 3300038443 Bacteria 1264
99 Ga0395901_0554943 3300038443 Bacteria 1164
100 Ga0395901_1897362 3300038443 Bacteria 543
101 Ga0395901_2040905 3300038443 Bacteria 519
102 Ga0451843_1534403 3300041509 Bacteria 557
103 Ga0439443_061276 3300042003 Bacteria 674
104 Ga0439456_098007 3300042013 Bacteria 662
105 Ga0439463_201926 3300042016 Bacteria 516
106 Ga0439435_0336905 3300042436 Bacteria 522
107 Ga0439460_0127096 3300042461 Bacteria 838
108 Ga0466966_0006118 3300044684 Bacteria 7952
109 Ga0466961_0026210 3300044693 Bacteria 3749
110 Ga0466971_0018988 3300044719 Bacteria 3050
111 Ga0466957_0453476 3300044842 Bacteria 884
112 Ga0466959_0004311 3300045049 Bacteria 9498
113 Ga0466959_0831870 3300045049 Bacteria 617
114 Ga0466958_0039477 3300045836 Bacteria 2837
115 Ga0466967_0276183 3300045976 Bacteria 1611
116 Ga0495603_0221233 3300046455 Bacteria 1092
117 Ga0495628_0810333 3300046516 Bacteria 655
118 Ga0495644_0077582 3300046523 Bacteria 1252
119 Ga0495644_0374586 3300046523 Bacteria 562
120 Ga0495642_0076756 3300046528 Bacteria 1403
121 Ga0495652_0058803 3300046529 Bacteria 3254
122 Ga0495645_0096465 3300046543 Bacteria 2107
123 Ga0495635_0561472 3300046663 Bacteria 748
124 Ga0495646_0296246 3300046680 Bacteria 857
125 Ga0495669_0640200 3300046684 Bacteria 517
126 Ga0495613_0745469 3300046689 Bacteria 642
127 Ga0496102_0047342 3300048905 Bacteria 3907
128 Ga0496111_1354399 3300048914 Bacteria 500
129 Ga0496112_0339904 3300048915 Bacteria 1445
130 Ga0496116_0000211 3300048919 Bacteria 109352
131 Ga0496117_0007777 3300048920 Bacteria 10338
132 Ga0496118_0008402 3300048921 Bacteria 10681
133 Ga0496119_0006624 3300048922 Bacteria 10660
134 Ga0501031_0289989 3300049568 Bacteria 1061
135 Ga0501038_0278135 3300049574 Bacteria 1318
136 Ga0501039_0102805 3300049575 Bacteria 2230
137 Ga0501040_0747297 3300049576 Bacteria 708
138 Ga0501041_0350334 3300049577 Bacteria 933
139 Ga0501042_0661468 3300049578 Bacteria 759
140 Ga0501046_1273686 3300049580 Bacteria 503
141 Ga0501047_0117242 3300049581 Bacteria 2544
142 Ga0501047_0830171 3300049581 Bacteria 738
143 Ga0501048_0053587 3300049582 Bacteria 2868
144 Ga0501068_0072115 3300049584 Bacteria 2109
145 Ga0501072_0629140 3300049588 Bacteria 845
146 Ga0501075_0651835 3300049591 Bacteria 803
147 Ga0501207_127547 3300049654 Bacteria 532
148 Ga0501079_0013601 3300049741 Bacteria 6207
149 Ga0501079_0596824 3300049741 Bacteria 869
150 Ga0501080_0082825 3300049742 Bacteria 2980
151 Ga0501081_0971472 3300049743 Bacteria 641
152 Ga0501045_0528691 3300049824 Bacteria 875
153 nmdc:mga00v17_622308_c1 3300050491 Bacteria 695
154 nmdc:mga00v17_863377_c1 3300050491 Bacteria 574
155 nmdc:mga05p37_1019572_c1 3300050507 Bacteria 877
156 nmdc:mga05p37_32502_c1 3300050507 Bacteria 6382
157 nmdc:mga05p37_503813_c1 3300050507 Bacteria 1389
158 nmdc:mga09592_1230352_c1 3300050508 Bacteria 618
159 nmdc:mga06r32_88010_c1 3300050510 Bacteria 3031
160 nmdc:mga08y16_41785_c1 3300050511 Bacteria 4802
161 nmdc:mga0n895_1407529_c1 3300050512 Bacteria 666
162 nmdc:mga0n895_50345_c1 3300050512 Bacteria 4084
163 nmdc:mga0rr50_34957_c1 3300050513 Bacteria 3605
164 nmdc:mga0rr50_436110_c1 3300050513 Bacteria 1109
165 nmdc:mga08x19_7148_c1 3300050514 Bacteria 6630
166 nmdc:mga0a205_355633_c1 3300050515 Bacteria 1332
167 nmdc:mga0a205_357818_c1 3300050515 Bacteria 1326
168 Ga0495619_0889819 3300053085 Bacteria 599
169 Ga0500616_0001424 3300053153 Bacteria 23016
170 Ga0501084_0096297 3300054114 Bacteria 2486
171 Ga0590075_164699 3300059424 Bacteria 585
172 Ga0501082_0005382 3300060353 Bacteria 11108
173 Ga0501082_0897913 3300060353 Bacteria 775
174 Ga0501082_0995068 3300060353 Bacteria 733
175 Ga0466962_0017993 3300061719 Bacteria 3400
176 Ga0439454_003326
177 Ga0070687_101177677
178 Ga0070714_100066279
179 Ga0070713_101744786
180 Ga0070705_100566879
181 Ga0070708_100024766
182 Ga0070708_101370738
183 Ga0068867_101708763
184 Ga0070707_100360038
185 Ga0070699_100019976
186 Ga0070695_100411253
187 Ga0070693_100314555
188 Ga0068855_100509249
189 Ga0068861_100170149
190 Ga0068861_101300507
191 Ga0081455_10005858
192 Ga0081455_10006507
193 Ga0081455_10276152
194 Ga0081455_10366849
195 Ga0081539_10004965
196 Ga0081539_10165308
197 Ga0075364_10453495
198 Ga0075432_10092478
199 Ga0075428_100296387
200 Ga0075431_100024220
201 Ga0075431_100283654
202 Ga0075433_10037733
203 Ga0075434_100524032
204 Ga0075434_101818183
205 Ga0075436_100028199
206 Ga0075435_100042011
207 Ga0075435_100144288
208 Ga0111539_10011905
209 Ga0105245_11162058
210 Ga0114129_10178356
211 Ga0114129_11158096
212 Ga0114129_11214928
213 Ga0114129_13193500
214 Ga0105243_10928606
215 Ga0105242_11932531
216 Ga0105237_12027446
217 Ga0105239_12353158
218 Ga0157378_11505947
219 Ga0157372_12710615
220 Ga0157379_11547697
221 Ga0207685_10395415
222 Ga0207662_10268566
223 Ga0207646_11664143
224 Ga0207687_10715655
225 Ga0207664_10039644
226 Ga0207667_10850486
227 Ga0207675_100201788
228 Ga0207698_11622350
229 Ga0207428_10074504
230 Ga0307408_100243253
231 Ga0307405_10250827
232 Ga0307410_11829417
233 Ga0307407_10051374
234 Ga0307407_11026338
235 Ga0307412_11048122
236 Ga0307409_100037761
237 Ga0307416_100040958
238 Ga0307416_100792793
239 Ga0307416_101591972
240 Ga0307411_11413460
241 Ga0307415_100073252
242 Ga0307415_101446180
243 Ga0373937_1666461
244 Ga0395899_0011311
245 Ga0395899_0070132
246 Ga0395899_0389835
247 Ga0395899_0727242
248 Ga0395899_0819469
249 Ga0395900_0002514
250 Ga0395900_0007170
251 Ga0395900_0140985
252 Ga0395900_0194812
253 Ga0395900_0715111
254 Ga0395900_1111070
255 Ga0395898_0008930
256 Ga0395898_0281114
257 Ga0395898_0298394
258 Ga0395898_0336964
259 Ga0395898_0563387
260 Ga0395898_0704606
261 Ga0395898_1166879
262 Ga0395905_0003227
263 Ga0395905_0011340
264 Ga0395905_0313162
265 Ga0395905_0811114
266 Ga0395905_0903372
267 Ga0395905_1779265
268 Ga0395901_0004579
269 Ga0395901_0023940
270 Ga0395901_0067708
271 Ga0395901_0226450
272 Ga0395901_0251973
273 Ga0395901_0482276
274 Ga0395901_0554943
275 Ga0395901_1897362
276 Ga0395901_2040905
277 Ga0451843_1534403
278 Ga0439443_061276
279 Ga0439456_098007
280 Ga0439463_201926
281 Ga0439435_0336905
282 Ga0439460_0127096
283 Ga0466966_0006118
284 Ga0466961_0026210
285 Ga0466971_0018988
286 Ga0466957_0453476
287 Ga0466959_0004311
288 Ga0466959_0831870
289 Ga0466958_0039477
290 Ga0466967_0276183
291 Ga0495603_0221233
292 Ga0495628_0810333
293 Ga0495644_0077582
294 Ga0495644_0374586
295 Ga0495642_0076756
296 Ga0495652_0058803
297 Ga0495645_0096465
298 Ga0495635_0561472
299 Ga0495646_0296246
300 Ga0495669_0640200
301 Ga0495613_0745469
302 Ga0496102_0047342
303 Ga0496111_1354399
304 Ga0496112_0339904
305 Ga0496116_0000211
306 Ga0496117_0007777
307 Ga0496118_0008402
308 Ga0496119_0006624
309 Ga0501031_0289989
310 Ga0501038_0278135
311 Ga0501039_0102805
312 Ga0501040_0747297
313 Ga0501041_0350334
314 Ga0501042_0661468
315 Ga0501046_1273686
316 Ga0501047_0117242
317 Ga0501047_0830171
318 Ga0501048_0053587
319 Ga0501068_0072115
320 Ga0501072_0629140
321 Ga0501075_0651835
322 Ga0501207_127547
323 Ga0501079_0013601
324 Ga0501079_0596824
325 Ga0501080_0082825
326 Ga0501081_0971472
327 Ga0501045_0528691
328 nmdc:mga00v17_622308_c1
329 nmdc:mga00v17_863377_c1
330 nmdc:mga05p37_1019572_c1
331 nmdc:mga05p37_32502_c1
332 nmdc:mga05p37_503813_c1
333 nmdc:mga09592_1230352_c1
334 nmdc:mga06r32_88010_c1
335 nmdc:mga08y16_41785_c1
336 nmdc:mga0n895_1407529_c1
337 nmdc:mga0n895_50345_c1
338 nmdc:mga0rr50_34957_c1
339 nmdc:mga0rr50_436110_c1
340 nmdc:mga08x19_7148_c1
341 nmdc:mga0a205_355633_c1
342 nmdc:mga0a205_357818_c1
343 Ga0495619_0889819
344 Ga0500616_0001424
345 Ga0501084_0096297
346 Ga0590075_164699
347 Ga0501082_0005382
348 Ga0501082_0897913
349 Ga0501082_0995068
350 Ga0466962_0017993

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02583

Trns_repr_metal

Metal-sensitive transcriptional repressor

32

113

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j0k-assembly1.cif.gz_B de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.8902 21 72
8d06-assembly4.cif.gz_K hallucinated c3 protein assembly halc3_104 0.8873 21 68
7mq2-assembly1.cif.gz_C c9a streptococcus pneumoniae cstr in the reduced state, space group p21 0.8437 19 81
6ahx-assembly1.cif.gz_A-2 copper-sensing operon regulator protein (csorgz) 0.8381 17 76
7mq2-assembly1.cif.gz_C c9a streptococcus pneumoniae cstr in the reduced state, space group p21 0.82 19 81
ID Description Score Start End Superfamily
af_Q9SW96_213_301_1.10.287.10 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.8878 18 65 1.10.287.10
af_A0A1D6FII0_204_293_1.10.287.10 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.839 11 67 1.10.287.10
af_P0AAP3_1_91_1.20.58.1000 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.831 18 99 1.20.58.1000
af_P0AAP3_1_91_1.20.58.1000 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.7499 18 99 1.20.58.1000
4uigA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.7494 20 99 1.20.58.1000
ID Description Score Start End GO Terms
AF-A0A2S5TCQ2-F1-model_v4 Metal/formaldehyde-sensitive transcriptional repressor 0.8881 20 99 GO:0003677
GO:0005737
GO:0045892
GO:0046872
AF-A0A1F8FC94-F1-model_v4 Transcriptional regulator 0.8686 19 95 GO:0003677
GO:0045892
GO:0046872
AF-A0A2I8CYV5-F1-model_v4 deleted 0.8624 20 99
AF-F2NMZ4-F1-model_v4 Metal sensitive transcriptional repressor 0.8611 20 98 GO:0003677
GO:0005737
GO:0045892
GO:0046872
AF-A0A6N6VU19-F1-model_v4 Metal-sensing transcriptional repressor 0.8591 18 99 GO:0003677
GO:0005737
GO:0045892
GO:0046872

Map