F266250

General Info

Members Datasets Scaffolds Average Seq Length
175 127 173 93

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10894697|Ga0105245_108946972
Length 111
Sequence MCLFGYLTRINKKFILSLVIASFACPETERFFATGKSRRFPPDVQKRAAMRLIQLDAATTINDLRFPPSNRMERLKKDRKGEWSIRVNDQWRICFRFTDGDAFDVEIVDYH

Samples

Sample ID Description Type Environment
1 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
38 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
54 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
55 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
56 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
57 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
58 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
59 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
67 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
68 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
69 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
73 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
74 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
75 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
80 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
81 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
84 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
91 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
96 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
97 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
98 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
99 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
112 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
122 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
123 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
124 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
127 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96
Metatranscriptomes 2.86
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 1.71
Rhizosphere 89.14
Stem 0
Stem Tuber 0
Unclassified 8.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100288243 3300005336 Bacteria 1391
2 Ga0070682_100067364 3300005337 Unclassified 2280
3 Ga0070660_100983288 3300005339 Bacteria 713
4 Ga0070691_10074925 3300005341 Bacteria 1647
5 Ga0070661_100152827 3300005344 Bacteria 1746
6 Ga0070692_10934131 3300005345 Bacteria 602
7 Ga0070709_11189556 3300005434 Unclassified 612
8 Ga0070681_10000002 3300005458 Bacteria 821814
9 Ga0070681_10043872 3300005458 Bacteria 4476
10 Ga0070699_100354543 3300005518 Bacteria 1322
11 Ga0070679_100000393 3300005530 Bacteria 37212
12 Ga0070679_100404131 3300005530 Bacteria 1311
13 Ga0070697_100097049 3300005536 Unclassified 2445
14 Ga0070697_100251435 3300005536 Unclassified 1511
15 Ga0068853_100014250 3300005539 Bacteria 6507
16 Ga0070695_100703294 3300005545 Bacteria 802
17 Ga0068855_100140060 3300005563 Bacteria 2758
18 Ga0068856_101137448 3300005614 Bacteria 798
19 Ga0070702_100237209 3300005615 Bacteria 1229
20 Ga0068858_101677409 3300005842 Bacteria 627
21 Ga0097621_101621904 3300006237 Bacteria 615
22 Ga0075428_101895131 3300006844 Bacteria 619
23 Ga0075430_100763419 3300006846 Bacteria 797
24 Ga0075434_101347620 3300006871 Bacteria 724
25 Ga0075429_100905707 3300006880 Bacteria 772
26 Ga0075435_100014339 3300007076 Bacteria 5920
27 Ga0099794_10648276 3300007265 Bacteria 561
28 Ga0105240_10717950 3300009093 Bacteria 1089
29 Ga0105245_10037016 3300009098 Bacteria 4336
30 Ga0105245_10894697 3300009098 Bacteria 929
31 Ga0114129_10288356 3300009147 Bacteria 2191
32 Ga0114129_12286683 3300009147 Unclassified 649
33 Ga0114129_13465139 3300009147 Unclassified 505
34 Ga0105243_11286919 3300009148 Bacteria 748
35 Ga0105243_11894487 3300009148 Unclassified 629
36 Ga0105242_10043124 3300009176 Bacteria 3648
37 Ga0105242_11523409 3300009176 Bacteria 700
38 Ga0105248_11412682 3300009177 Bacteria 787
39 Ga0105238_10304753 3300009551 Bacteria 1577
40 Ga0105239_11818237 3300010375 Unclassified 706
41 Ga0157373_11223362 3300013100 Bacteria 567
42 Ga0157369_10295314 3300013105 Bacteria 1686
43 Ga0157375_13026124 3300013308 Bacteria 561
44 Ga0213873_10029686 3300021358 Unclassified 1349
45 Ga0213874_10036732 3300021377 Unclassified 1446
46 Ga0213874_10117610 3300021377 Unclassified 900
47 Ga0213876_10156908 3300021384 Bacteria 1210
48 Ga0207707_10000002 3300025912 Bacteria 1142054
49 Ga0207707_10019437 3300025912 Bacteria 5930
50 Ga0207695_10011647 3300025913 Bacteria 10627
51 Ga0207660_10114853 3300025917 Bacteria 2031
52 Ga0207649_10181204 3300025920 Bacteria 1475
53 Ga0207652_10000052 3300025921 Bacteria 119002
54 Ga0207652_11086017 3300025921 Bacteria 700
55 Ga0207694_10074516 3300025924 Bacteria 2657
56 Ga0207644_10060411 3300025931 Bacteria 2743
57 Ga0207686_10050541 3300025934 Bacteria 2585
58 Ga0207709_10828398 3300025935 Bacteria 748
59 Ga0207691_11153932 3300025940 Bacteria 643
60 Ga0207667_10007827 3300025949 Bacteria 12772
61 Ga0207667_10196826 3300025949 Unclassified 2067
62 Ga0307515_10148821 3300028794 Bacteria 2461
63 Ga0265338_10745973 3300028800 Bacteria 673
64 Ga0265330_10032853 3300031235 Bacteria 2324
65 Ga0265332_10066290 3300031238 Bacteria 1541
66 Ga0265328_10307240 3300031239 Bacteria 613
67 Ga0265320_10000191 3300031240 Bacteria 50802
68 Ga0265325_10019604 3300031241 Bacteria 3736
69 Ga0265325_10051931 3300031241 Bacteria 2106
70 Ga0265325_10078524 3300031241 Bacteria 1644
71 Ga0265325_10343026 3300031241 Bacteria 661
72 Ga0265329_10347527 3300031242 Bacteria 507
73 Ga0265339_10052747 3300031249 Bacteria 2214
74 Ga0265331_10231001 3300031250 Bacteria 831
75 Ga0265327_10085104 3300031251 Bacteria 1553
76 Ga0307509_10768259 3300031507 Bacteria 629
77 Ga0265313_10004638 3300031595 Bacteria 10412
78 Ga0316579_10129734 3300031691 Bacteria 1214
79 Ga0265314_10017545 3300031711 Bacteria 5615
80 Ga0316576_10012252 3300031727 Bacteria 5659
81 Ga0316576_10038358 3300031727 Bacteria 3435
82 Ga0316576_10159037 3300031727 Bacteria 1703
83 Ga0316576_10198928 3300031727 Unclassified 1510
84 Ga0316576_10230835 3300031727 Bacteria 1391
85 Ga0316576_10232970 3300031727 Unclassified 1384
86 Ga0316576_10577904 3300031727 Bacteria 822
87 Ga0316576_10773274 3300031727 Bacteria 692
88 Ga0316578_10029124 3300031728 Bacteria 3132
89 Ga0316578_10161687 3300031728 Bacteria 1349
90 Ga0316578_10193355 3300031728 Bacteria 1225
91 Ga0316578_10578357 3300031728 Bacteria 659
92 Ga0307516_10124589 3300031730 Bacteria 2363
93 Ga0316577_10062100 3300031733 Bacteria 2086
94 Ga0316577_10258839 3300031733 Bacteria 984
95 Ga0316577_10863942 3300031733 Bacteria 513
96 Ga0307416_100169671 3300032002 Bacteria 2029
97 Ga0307411_12063963 3300032005 Archaea 533
98 Ga0316583_10037262 3300032133 Bacteria 1724
99 Ga0316583_10115965 3300032133 Bacteria 934
100 Ga0316585_10062566 3300032137 Bacteria 1203
101 Ga0316585_10084785 3300032137 Bacteria 1034
102 Ga0316580_10008704 3300032139 Bacteria 3045
103 Ga0316580_10238704 3300032139 Unclassified 561
104 Ga0316580_10277557 3300032139 Bacteria 519
105 Ga0316593_10110521 3300032168 Bacteria 981
106 Ga0316593_10154797 3300032168 Bacteria 835
107 Ga0316592_1040622 3300033524 Bacteria 1029
108 Ga0316588_1034586 3300033528 Bacteria 1194
109 Ga0316596_1020148 3300033541 Bacteria 1695
110 Ga0373941_0034387 3300035115 Bacteria 1529
111 Ga0316574_0058364 3300035398 Bacteria 2417
112 Ga0316574_0275928 3300035398 Bacteria 1071
113 Ga0373933_0601304 3300035724 Bacteria 722
114 Ga0373937_0050868 3300036401 Bacteria 3797
115 Ga0316582_0062902 3300036647 Bacteria 2384
116 Ga0316582_0134931 3300036647 Bacteria 1660
117 Ga0316582_0266375 3300036647 Bacteria 1175
118 Ga0316584_0041020 3300036712 Bacteria 3450
119 Ga0316584_0095317 3300036712 Bacteria 2228
120 Ga0316584_0148006 3300036712 Bacteria 1749
121 Ga0316584_0158645 3300036712 Bacteria 1681
122 Ga0316584_0197802 3300036712 Bacteria 1484
123 Ga0436364_1470844 3300037853 Bacteria 1412
124 Ga0400489_60413 3300039093 Bacteria 1512
125 Ga0436365_0421125 3300039437 Unclassified 1227
126 Ga0436365_0659153 3300039437 Bacteria 13360
127 Ga0436365_1912660 3300039437 Bacteria 6342
128 Ga0436361_0208177 3300039447 Unclassified 584
129 Ga0436363_0075012 3300039450 Unclassified 1003
130 Ga0436363_0568743 3300039450 Bacteria 6093
131 Ga0436363_1497272 3300039450 Unclassified 549
132 Ga0436362_0415394 3300039453 Bacteria 672
133 Ga0436362_1182238 3300039453 Bacteria 1727
134 Ga0451797_1311475 3300041453 Unclassified 521
135 Ga0451577_0310652 3300042876 Bacteria 1429
136 Ga0453683_0000001 3300044673 Bacteria 1384965
137 Ga0451576_0114022 3300045051 Bacteria 2813
138 Ga0451576_0680311 3300045051 Bacteria 1081
139 Ga0495637_0321503 3300046520 Bacteria 546
140 Ga0495588_0656086 3300046674 Bacteria 549
141 Ga0495677_0119885 3300047445 Bacteria 1003
142 Ga0495686_0287870 3300047472 Bacteria 911
143 Ga0495615_0089469 3300048090 Unclassified 856
144 Ga0496109_0336660 3300048912 Unclassified 1425
145 Ga0496111_0118732 3300048914 Unclassified 1952
146 Ga0496119_0179786 3300048922 Bacteria 1110
147 Ga0501032_0416763 3300049569 Bacteria 862
148 Ga0501033_0261837 3300049570 Bacteria 1224
149 Ga0501034_0001210 3300049571 Bacteria 35418
150 Ga0501037_0998437 3300049573 Bacteria 545
151 Ga0501038_1255258 3300049574 Bacteria 536
152 Ga0501040_0357709 3300049576 Bacteria 1046
153 Ga0501043_0565008 3300049579 Bacteria 844
154 Ga0501048_1406222 3300049582 Bacteria 501
155 Ga0501068_0431075 3300049584 Bacteria 852
156 Ga0501071_0076660 3300049587 Bacteria 2442
157 Ga0501073_0891843 3300049589 Bacteria 612
158 Ga0501075_0093675 3300049591 Bacteria 2280
159 Ga0501075_1399752 3300049591 Bacteria 530
160 Ga0501080_0781932 3300049742 Bacteria 838
161 Ga0501080_0912101 3300049742 Bacteria 765
162 Ga0501083_0528389 3300049744 Bacteria 768
163 Ga0501035_0686309 3300049822 Bacteria 827
164 Ga0501044_1357968 3300049823 Bacteria 577
165 nmdc:mga05p37_275566_c1 3300050507 Bacteria 2009
166 nmdc:mga09592_892108_c1 3300050508 Bacteria 748
167 nmdc:mga0rr50_45749_c1 3300050513 Bacteria 3219
168 Ga0500636_0007347 3300053177 Bacteria 6368
169 Ga0501084_0120324 3300054114 Bacteria 2208
170 Ga0501084_0928957 3300054114 Bacteria 732
171 Ga0590071_129182 3300059421 Unclassified 648
172 Ga0501082_0125181 3300060353 Bacteria 2229
173 Ga0530510_0027319 3300061734 Bacteria 4089

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005345 Ga0070692_10934131 Ga0070692_109341311 77
2 3300021384 Ga0213876_10156908 Ga0213876_101569084 80
3 3300039437 Ga0436365_1912660 Ga0436365_1912660_2211_2459 80
4 3300005458 Ga0070681_10000002 Ga0070681_10000002764 82
5 3300005530 Ga0070679_100000393 Ga0070679_10000039313 82
6 3300009148 Ga0105243_11894487 Ga0105243_118944872 82
7 3300013105 Ga0157369_10295314 Ga0157369_102953143 82
8 3300025912 Ga0207707_10000002 Ga0207707_10000002194 82
9 3300025921 Ga0207652_10000052 Ga0207652_1000005251 82
10 iso_pu_bacteria 3005409236 3005412232 89
11 iso_pu_bacteria 8021648035 8021648463 89
12 3300041453 Ga0451797_1311475 Ga0451797_1311475_203_478 91
13 3300006846 Ga0075430_100763419 Ga0075430_1007634192 92
14 3300021358 Ga0213873_10029686 Ga0213873_100296861 92
15 3300021377 Ga0213874_10036732 Ga0213874_100367323 92
16 3300021377 Ga0213874_10117610 Ga0213874_101176103 92
17 3300028800 Ga0265338_10745973 Ga0265338_107459731 92
18 3300031235 Ga0265330_10032853 Ga0265330_100328532 92
19 3300031238 Ga0265332_10066290 Ga0265332_100662902 92
20 3300031239 Ga0265328_10307240 Ga0265328_103072401 92
21 3300031240 Ga0265320_10000191 Ga0265320_100001918 92
22 3300031241 Ga0265325_10019604 Ga0265325_100196042 92
23 3300031241 Ga0265325_10078524 Ga0265325_100785242 92
24 3300031241 Ga0265325_10343026 Ga0265325_103430262 92
25 3300031242 Ga0265329_10347527 Ga0265329_103475272 92
26 3300031249 Ga0265339_10052747 Ga0265339_100527473 92
27 3300031595 Ga0265313_10004638 Ga0265313_100046385 92
28 3300031711 Ga0265314_10017545 Ga0265314_100175455 92
29 3300031730 Ga0307516_10124589 Ga0307516_101245892 92
30 3300037853 Ga0436364_1470844 Ga0436364_1470844_153_431 92
31 3300039437 Ga0436365_0421125 Ga0436365_0421125_287_571 92
32 3300039437 Ga0436365_0659153 Ga0436365_0659153_6443_6721 92
33 3300039450 Ga0436363_0075012 Ga0436363_0075012_604_888 92
34 3300039450 Ga0436363_0568743 Ga0436363_0568743_4927_5205 92
35 3300039450 Ga0436363_1497272 Ga0436363_1497272_103_381 92
36 3300039453 Ga0436362_1182238 Ga0436362_1182238_1002_1280 92
37 3300048922 Ga0496119_0179786 Ga0496119_0179786_71_349 92
38 3300049569 Ga0501032_0416763 Ga0501032_0416763_413_697 92
39 3300049742 Ga0501080_0781932 Ga0501080_0781932_488_772 92
40 3300049742 Ga0501080_0912101 Ga0501080_0912101_283_567 92
41 3300049822 Ga0501035_0686309 Ga0501035_0686309_293_577 92
42 3300005336 Ga0070680_100288243 Ga0070680_1002882432 93
43 3300005337 Ga0070682_100067364 Ga0070682_1000673642 93
44 3300005339 Ga0070660_100983288 Ga0070660_1009832882 93
45 3300005341 Ga0070691_10074925 Ga0070691_100749252 93
46 3300005344 Ga0070661_100152827 Ga0070661_1001528272 93
47 3300005434 Ga0070709_11189556 Ga0070709_111895562 93
48 3300005458 Ga0070681_10043872 Ga0070681_100438722 93
49 3300005518 Ga0070699_100354543 Ga0070699_1003545431 93
50 3300005530 Ga0070679_100404131 Ga0070679_1004041312 93
51 3300005536 Ga0070697_100097049 Ga0070697_1000970492 93
52 3300005536 Ga0070697_100251435 Ga0070697_1002514353 93
53 3300005539 Ga0068853_100014250 Ga0068853_1000142503 93
54 3300005545 Ga0070695_100703294 Ga0070695_1007032942 93
55 3300005563 Ga0068855_100140060 Ga0068855_1001400602 93
56 3300005614 Ga0068856_101137448 Ga0068856_1011374482 93
57 3300005615 Ga0070702_100237209 Ga0070702_1002372092 93
58 3300005842 Ga0068858_101677409 Ga0068858_1016774092 93
59 3300006237 Ga0097621_101621904 Ga0097621_1016219042 93
60 3300006844 Ga0075428_101895131 Ga0075428_1018951312 93
61 3300006871 Ga0075434_101347620 Ga0075434_1013476202 93
62 3300006880 Ga0075429_100905707 Ga0075429_1009057072 93
63 3300007076 Ga0075435_100014339 Ga0075435_1000143396 93
64 3300007265 Ga0099794_10648276 Ga0099794_106482762 93
65 3300009093 Ga0105240_10717950 Ga0105240_107179502 93
66 3300009098 Ga0105245_10037016 Ga0105245_100370163 93
67 3300009098 Ga0105245_10894697 Ga0105245_108946972 93
68 3300009147 Ga0114129_10288356 Ga0114129_102883562 93
69 3300009147 Ga0114129_12286683 Ga0114129_122866832 93
70 3300009147 Ga0114129_13465139 Ga0114129_134651391 93
71 3300009148 Ga0105243_11286919 Ga0105243_112869191 93
72 3300009176 Ga0105242_10043124 Ga0105242_100431244 93
73 3300009176 Ga0105242_11523409 Ga0105242_115234092 93
74 3300009177 Ga0105248_11412682 Ga0105248_114126822 93
75 3300009551 Ga0105238_10304753 Ga0105238_103047532 93
76 3300010375 Ga0105239_11818237 Ga0105239_118182372 93
77 3300013100 Ga0157373_11223362 Ga0157373_112233622 93
78 3300013308 Ga0157375_13026124 Ga0157375_130261242 93
79 3300025912 Ga0207707_10019437 Ga0207707_100194372 93
80 3300025913 Ga0207695_10011647 Ga0207695_1001164711 93
81 3300025917 Ga0207660_10114853 Ga0207660_101148534 93
82 3300025920 Ga0207649_10181204 Ga0207649_101812042 93
83 3300025921 Ga0207652_11086017 Ga0207652_110860171 93
84 3300025924 Ga0207694_10074516 Ga0207694_100745163 93
85 3300025931 Ga0207644_10060411 Ga0207644_100604114 93
86 3300025934 Ga0207686_10050541 Ga0207686_100505413 93
87 3300025935 Ga0207709_10828398 Ga0207709_108283983 93
88 3300025940 Ga0207691_11153932 Ga0207691_111539322 93
89 3300025949 Ga0207667_10007827 Ga0207667_100078278 93
90 3300025949 Ga0207667_10196826 Ga0207667_101968263 93
91 3300028794 Ga0307515_10148821 Ga0307515_101488214 93
92 3300031241 Ga0265325_10051931 Ga0265325_100519313 93
93 3300031250 Ga0265331_10231001 Ga0265331_102310011 93
94 3300031251 Ga0265327_10085104 Ga0265327_100851043 93
95 3300031507 Ga0307509_10768259 Ga0307509_107682592 93
96 3300031691 Ga0316579_10129734 Ga0316579_101297343 93
97 3300031727 Ga0316576_10012252 Ga0316576_100122527 93
98 3300031727 Ga0316576_10038358 Ga0316576_100383587 93
99 3300031727 Ga0316576_10159037 Ga0316576_101590371 93
100 3300031727 Ga0316576_10198928 Ga0316576_101989281 93
101 3300031727 Ga0316576_10230835 Ga0316576_102308353 93
102 3300031727 Ga0316576_10232970 Ga0316576_102329703 93
103 3300031727 Ga0316576_10577904 Ga0316576_105779041 93
104 3300031727 Ga0316576_10773274 Ga0316576_107732742 93
105 3300031728 Ga0316578_10029124 Ga0316578_100291244 93
106 3300031728 Ga0316578_10161687 Ga0316578_101616871 93
107 3300031728 Ga0316578_10193355 Ga0316578_101933553 93
108 3300031728 Ga0316578_10578357 Ga0316578_105783571 93
109 3300031733 Ga0316577_10062100 Ga0316577_100621004 93
110 3300031733 Ga0316577_10258839 Ga0316577_102588392 93
111 3300031733 Ga0316577_10863942 Ga0316577_108639421 93
112 3300032002 Ga0307416_100169671 Ga0307416_1001696712 93
113 3300032005 Ga0307411_12063963 Ga0307411_120639632 93
114 3300032133 Ga0316583_10037262 Ga0316583_100372623 93
115 3300032133 Ga0316583_10115965 Ga0316583_101159652 93
116 3300032137 Ga0316585_10062566 Ga0316585_100625663 93
117 3300032137 Ga0316585_10084785 Ga0316585_100847852 93
118 3300032139 Ga0316580_10008704 Ga0316580_100087043 93
119 3300032139 Ga0316580_10238704 Ga0316580_102387041 93
120 3300032139 Ga0316580_10277557 Ga0316580_102775571 93
121 3300032168 Ga0316593_10110521 Ga0316593_101105212 93
122 3300032168 Ga0316593_10154797 Ga0316593_101547972 93
123 3300033524 Ga0316592_1040622 Ga0316592_10406221 93
124 3300033528 Ga0316588_1034586 Ga0316588_10345861 93
125 3300033541 Ga0316596_1020148 Ga0316596_10201483 93
126 3300035115 Ga0373941_0034387 Ga0373941_0034387_1092_1424 93
127 3300035398 Ga0316574_0058364 Ga0316574_0058364_804_1085 93
128 3300035398 Ga0316574_0275928 Ga0316574_0275928_185_466 93
129 3300035724 Ga0373933_0601304 Ga0373933_0601304_146_427 93
130 3300036401 Ga0373937_0050868 Ga0373937_0050868_151_432 93
131 3300036647 Ga0316582_0062902 Ga0316582_0062902_638_919 93
132 3300036647 Ga0316582_0134931 Ga0316582_0134931_418_699 93
133 3300036647 Ga0316582_0266375 Ga0316582_0266375_94_375 93
134 3300036712 Ga0316584_0041020 Ga0316584_0041020_1353_1634 93
135 3300036712 Ga0316584_0095317 Ga0316584_0095317_985_1266 93
136 3300036712 Ga0316584_0148006 Ga0316584_0148006_1310_1591 93
137 3300036712 Ga0316584_0158645 Ga0316584_0158645_675_956 93
138 3300036712 Ga0316584_0197802 Ga0316584_0197802_1015_1296 93
139 3300039093 Ga0400489_60413 Ga0400489_60413_912_1193 93
140 3300039447 Ga0436361_0208177 Ga0436361_0208177_284_565 93
141 3300039453 Ga0436362_0415394 Ga0436362_0415394_216_497 93
142 3300042876 Ga0451577_0310652 Ga0451577_0310652_648_929 93
143 3300044673 Ga0453683_0000001 Ga0453683_0000001_1314153_1314434 93
144 3300045051 Ga0451576_0114022 Ga0451576_0114022_1622_1903 93
145 3300045051 Ga0451576_0680311 Ga0451576_0680311_150_431 93
146 3300046520 Ga0495637_0321503 Ga0495637_0321503_192_473 93
147 3300046674 Ga0495588_0656086 Ga0495588_0656086_63_344 93
148 3300047445 Ga0495677_0119885 Ga0495677_0119885_340_621 93
149 3300047472 Ga0495686_0287870 Ga0495686_0287870_478_759 93
150 3300048090 Ga0495615_0089469 Ga0495615_0089469_71_352 93
151 3300048912 Ga0496109_0336660 Ga0496109_0336660_1083_1364 93
152 3300048914 Ga0496111_0118732 Ga0496111_0118732_279_560 93
153 3300049570 Ga0501033_0261837 Ga0501033_0261837_742_1023 93
154 3300049571 Ga0501034_0001210 Ga0501034_0001210_17202_17483 93
155 3300049573 Ga0501037_0998437 Ga0501037_0998437_203_484 93
156 3300049574 Ga0501038_1255258 Ga0501038_1255258_90_371 93
157 3300049576 Ga0501040_0357709 Ga0501040_0357709_110_391 93
158 3300049579 Ga0501043_0565008 Ga0501043_0565008_468_749 93
159 3300049582 Ga0501048_1406222 Ga0501048_1406222_51_335 93
160 3300049584 Ga0501068_0431075 Ga0501068_0431075_149_430 93
161 3300049587 Ga0501071_0076660 Ga0501071_0076660_119_406 93
162 3300049589 Ga0501073_0891843 Ga0501073_0891843_165_446 93
163 3300049591 Ga0501075_0093675 Ga0501075_0093675_23_310 93
164 3300049591 Ga0501075_1399752 Ga0501075_1399752_135_416 93
165 3300049744 Ga0501083_0528389 Ga0501083_0528389_409_690 93
166 3300049823 Ga0501044_1357968 Ga0501044_1357968_130_411 93
167 3300050507 nmdc:mga05p37_275566_c1 nmdc:mga05p37_275566_c1_480_767 93
168 3300050508 nmdc:mga09592_892108_c1 nmdc:mga09592_892108_c1_290_577 93
169 3300050513 nmdc:mga0rr50_45749_c1 nmdc:mga0rr50_45749_c1_1506_1838 93
170 3300053177 Ga0500636_0007347 Ga0500636_0007347_5182_5463 93
171 3300054114 Ga0501084_0120324 Ga0501084_0120324_1791_2072 93
172 3300054114 Ga0501084_0928957 Ga0501084_0928957_221_502 93
173 3300059421 Ga0590071_129182 Ga0590071_129182_181_468 93
174 3300060353 Ga0501082_0125181 Ga0501082_0125181_1835_2122 93
175 3300061734 Ga0530510_0027319 Ga0530510_0027319_1360_1641 93

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05015

HigB-like_toxin

RelE-like toxin of type II toxin-antitoxin system HigB

21

111

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iwh-assembly1.cif.gz_A structure of p. vulgaris higb toxin delta h92 0.9234 1 93
4yzv-assembly2.cif.gz_XY precleavage 70s structure of the p. vulgaris higb deltah92 toxin bound to the aca codon 0.9221 1 92
4px8-assembly1.cif.gz_A structure of p. vulgaris higb toxin 0.921 1 93
4yzv-assembly2.cif.gz_XY precleavage 70s structure of the p. vulgaris higb deltah92 toxin bound to the aca codon 0.9127 1 92
5ixl-assembly7.cif.gz_G structure of p. vulgaris higb toxin y91a variant 0.9112 1 93
ID Description Score Start End Superfamily
5ixlB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9188 1 93 3.30.2310.20
5ixlB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9005 1 93 3.30.2310.20
4mctB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8977 4 91 3.30.2310.20
4mctB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8702 4 91 3.30.2310.20
af_Q6L4S0_354_647_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7472 64 91 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A084ENV9-F1-model_v4 HigB toxin protein 1.004 1 90
AF-A0A850BW79-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9998 1 93
AF-A0A7Y7CKA5-F1-model_v4 deleted 0.9998 1 93
AF-A0A5N1IZG9-F1-model_v4 Plasmid maintenance system killer family protein 0.9994 1 93
AF-A0A7Y5F6N7-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9992 1 93

Feature Viewer

pLDDT pTM Quality
96.81 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map