F265363

General Info

Members Datasets Scaffolds Average Seq Length
174 133 348 247

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0111025|Ga0501044_0111025_767_1663
Length 298
Sequence MRAIALHAIRGAKCRDEIREGFWCSARPAVFAVSVSAILTSEAVHSIWRKTMSIAMVTGAGSGIGRVVARKLIDDGFTVLLVGRRKDKLQETADGASDENRAVPFACDVTDPASVETLFSFVEDRFGRLDVLFNNAGISAKGALPDELSIEDWTRVISTNLTGVYLVARGAFSLMRRQLPQGGRIINNGSVSSYVPRPHAIAYNASKHAVTGITKSLSLDGRPFNIACGQIDIGNVRTEMVSEIVSGIRQADNSLRSEPTFEVAHVADAVSYMARLPLEANVQFMTVMATTMPYIGRG

Samples

Sample ID Description Type Environment
1 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
72 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
73 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
80 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
99 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
109 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
129 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
130 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
131 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
132 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
133 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 0
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.02
Nodule 0
Rhizoplane 4.02
Rhizosphere 85.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501044_0111025 3300049823 Bacteria 2750
2 JGI25406J46586_10010517 3300003203 Bacteria 4103
3 Ga0055525_1000046 3300003759 Bacteria 261587
4 Ga0070658_10033184 3300005327 Bacteria 4152
5 Ga0070676_10214389 3300005328 Bacteria 1269
6 Ga0070670_100000817 3300005331 Bacteria 24262
7 Ga0068869_100145810 3300005334 Bacteria 1832
8 Ga0068868_100349685 3300005338 Bacteria 1266
9 Ga0070660_100465182 3300005339 Bacteria 1050
10 Ga0070687_100253174 3300005343 Bacteria 1095
11 Ga0070661_100157013 3300005344 Bacteria 1722
12 Ga0070668_100085064 3300005347 Bacteria 2485
13 Ga0070674_100203244 3300005356 Bacteria 1531
14 Ga0070673_100074347 3300005364 Bacteria 2739
15 Ga0070714_100023431 3300005435 Bacteria 5071
16 Ga0070714_100393171 3300005435 Bacteria 1309
17 Ga0070710_10000092 3300005437 Bacteria 40707
18 Ga0070700_100338264 3300005441 Bacteria 1112
19 Ga0070663_100295846 3300005455 Bacteria 1294
20 Ga0070678_100051990 3300005456 Bacteria 2973
21 Ga0070678_100285110 3300005456 Bacteria 1398
22 Ga0070662_100329315 3300005457 Bacteria 1247
23 Ga0068867_100084540 3300005459 Bacteria 2397
24 Ga0070685_10031408 3300005466 Bacteria 2967
25 Ga0070679_100064022 3300005530 Bacteria 3664
26 Ga0070679_100426109 3300005530 Bacteria 1272
27 Ga0068853_100047645 3300005539 Bacteria 3678
28 Ga0070672_100167528 3300005543 Bacteria 1825
29 Ga0068855_100469443 3300005563 Bacteria 1371
30 Ga0068854_100193326 3300005578 Bacteria 1595
31 Ga0070702_100001345 3300005615 Bacteria 10006
32 Ga0068852_100005822 3300005616 Bacteria 8851
33 Ga0068852_100044978 3300005616 Bacteria 3753
34 Ga0068852_100417572 3300005616 Bacteria 1323
35 Ga0068859_100358695 3300005617 Bacteria 1553
36 Ga0068860_100660261 3300005843 Bacteria 1054
37 Ga0081539_10003461 3300005985 Bacteria 19333
38 Ga0070717_10003753 3300006028 Bacteria 10905
39 Ga0070717_10550777 3300006028 Bacteria 1044
40 Ga0097620_100358701 3300006931 Bacteria 1553
41 Ga0105240_10103575 3300009093 Bacteria 3457
42 Ga0105243_10190888 3300009148 Bacteria 1789
43 Ga0105241_10125059 3300009174 Bacteria 2076
44 Ga0105241_10229745 3300009174 Bacteria 1563
45 Ga0105238_10370678 3300009551 Bacteria 1422
46 Ga0105249_10187747 3300009553 Bacteria 2015
47 Ga0157371_10059409 3300013102 Bacteria 2710
48 Ga0157370_10088978 3300013104 Bacteria 2900
49 Ga0157374_10530475 3300013296 Bacteria 1184
50 Ga0157378_10574612 3300013297 Bacteria 1135
51 Ga0157372_10057863 3300013307 Bacteria 4333
52 Ga0157380_10141268 3300014326 Bacteria 2069
53 Ga0163161_10126814 3300017792 Bacteria 1922
54 Ga0213872_10000161 3300021361 Bacteria 61406
55 Ga0209563_100005 3300025230 Bacteria 1774893
56 Ga0207692_10003880 3300025898 Bacteria 5873
57 Ga0207642_10137627 3300025899 Bacteria 1283
58 Ga0207710_10283469 3300025900 Bacteria 834
59 Ga0207645_10083579 3300025907 Bacteria 2048
60 Ga0207705_10149993 3300025909 Bacteria 1747
61 Ga0207654_10306980 3300025911 Bacteria 1081
62 Ga0207707_10222337 3300025912 Bacteria 1644
63 Ga0207695_10233423 3300025913 Bacteria 1743
64 Ga0207662_10026993 3300025918 Bacteria 3315
65 Ga0207657_10055543 3300025919 Bacteria 3420
66 Ga0207657_10057369 3300025919 Bacteria 3355
67 Ga0207649_10535776 3300025920 Bacteria 894
68 Ga0207652_10219919 3300025921 Bacteria 1711
69 Ga0207664_10002450 3300025929 Bacteria 12286
70 Ga0207690_10085583 3300025932 Bacteria 2213
71 Ga0207689_10092936 3300025942 Bacteria 2478
72 Ga0207667_10005402 3300025949 Bacteria 15581
73 Ga0207667_10264079 3300025949 Bacteria 1760
74 Ga0207640_10027214 3300025981 Bacteria 3481
75 Ga0207640_10280583 3300025981 Bacteria 1308
76 Ga0207702_10092072 3300026078 Bacteria 2656
77 Ga0207702_10362598 3300026078 Bacteria 1389
78 Ga0207683_10078137 3300026121 Bacteria 2932
79 Ga0207698_10100351 3300026142 Bacteria 2397
80 Ga0207698_10108757 3300026142 Bacteria 2318
81 Ga0207698_10203157 3300026142 Bacteria 1776
82 Ga0268264_10772003 3300028381 Bacteria 959
83 Ga0307515_10157547 3300028794 Bacteria 2334
84 Ga0316177_1145330 3300030731 Bacteria 3771
85 Ga0316176_1106977 3300030732 Bacteria 10918
86 Ga0314311_1180204 3300030733 Bacteria 1411
87 Ga0307513_10023992 3300031456 Bacteria 7107
88 Ga0307509_10174458 3300031507 Bacteria 2024
89 Ga0307410_10056722 3300031852 Bacteria 2665
90 Ga0307409_100621559 3300031995 Bacteria 1070
91 Ga0307416_100225496 3300032002 Bacteria 1802
92 Ga0307507_10007741 3300033179 Bacteria 15336
93 Ga0307507_10081169 3300033179 Bacteria 2853
94 Ga0316574_0028755 3300035398 Bacteria 3354
95 Ga0395899_0037811 3300037312 Bacteria 3617
96 Ga0395898_0236907 3300037466 Bacteria 1740
97 Ga0395898_0242036 3300037466 Bacteria 1721
98 Ga0395905_0000479 3300037471 Bacteria 55266
99 Ga0395905_0022606 3300037471 Bacteria 5945
100 Ga0395905_0086188 3300037471 Bacteria 2943
101 Ga0395905_0168062 3300037471 Bacteria 2061
102 Ga0395901_0147415 3300038443 Bacteria 2473
103 Ga0395901_0238824 3300038443 Bacteria 1895
104 Ga0400483_015376 3300039062 Bacteria 1380
105 Ga0400483_191564 3300039062 Bacteria 1768
106 Ga0436361_0481133 3300039447 Bacteria 61506
107 Ga0466969_0078734 3300044656 Bacteria 1576
108 Ga0466972_0023268 3300044658 Bacteria 3081
109 Ga0466965_0003804 3300044683 Bacteria 6655
110 Ga0466965_0041314 3300044683 Bacteria 2272
111 Ga0466961_0139701 3300044693 Bacteria 1517
112 Ga0466964_0200347 3300044706 Bacteria 958
113 Ga0466968_0191663 3300044735 Bacteria 954
114 Ga0466959_0059855 3300045049 Bacteria 2772
115 Ga0466958_0509221 3300045836 Bacteria 781
116 Ga0466967_0010170 3300045976 Bacteria 7037
117 Ga0466967_0735790 3300045976 Bacteria 978
118 Ga0495592_0361193 3300046454 Bacteria 929
119 Ga0495652_0156074 3300046529 Bacteria 1777
120 Ga0495598_0025927 3300046537 Bacteria 1603
121 Ga0495621_0006660 3300046539 Bacteria 3383
122 Ga0495604_0233798 3300047317 Bacteria 1260
123 Ga0495686_0002942 3300047472 Bacteria 15242
124 Ga0495686_0015338 3300047472 Bacteria 5237
125 Ga0496102_0067908 3300048905 Bacteria 3270
126 Ga0496102_0296228 3300048905 Bacteria 1525
127 Ga0496103_0286355 3300048906 Bacteria 1060
128 Ga0496106_0216984 3300048909 Bacteria 1525
129 Ga0496108_0089440 3300048911 Bacteria 2617
130 Ga0496109_0251057 3300048912 Bacteria 1666
131 Ga0496114_0386715 3300048917 Bacteria 1239
132 Ga0496122_0000092 3300048925 Bacteria 204463
133 Ga0496123_0000089 3300048926 Bacteria 179941
134 Ga0501031_0014598 3300049568 Bacteria 5107
135 Ga0501032_0029630 3300049569 Bacteria 3754
136 Ga0501033_0028790 3300049570 Bacteria 4174
137 Ga0501033_0075665 3300049570 Bacteria 2471
138 Ga0501033_0231048 3300049570 Bacteria 1314
139 Ga0501034_0029431 3300049571 Bacteria 5582
140 Ga0501034_0101624 3300049571 Bacteria 2869
141 Ga0501034_0305917 3300049571 Bacteria 1525
142 Ga0501036_0006365 3300049572 Bacteria 9580
143 Ga0501036_0084045 3300049572 Bacteria 2691
144 Ga0501037_0009930 3300049573 Bacteria 6981
145 Ga0501037_0037205 3300049573 Bacteria 3587
146 Ga0501038_0049588 3300049574 Bacteria 3630
147 Ga0501038_0091003 3300049574 Bacteria 2556
148 Ga0501042_0006123 3300049578 Bacteria 7794
149 Ga0501043_0028494 3300049579 Bacteria 4384
150 Ga0501043_0414772 3300049579 Bacteria 1016
151 Ga0501046_0245540 3300049580 Bacteria 1319
152 Ga0501047_0006134 3300049581 Bacteria 11295
153 Ga0501047_0018933 3300049581 Bacteria 6603
154 Ga0501047_0041534 3300049581 Bacteria 4444
155 Ga0501048_0035771 3300049582 Bacteria 3572
156 Ga0501067_0004865 3300049583 Bacteria 7457
157 Ga0501069_0049043 3300049585 Bacteria 2346
158 Ga0501070_0048542 3300049586 Bacteria 3525
159 Ga0501074_0015300 3300049590 Bacteria 5576
160 Ga0501080_0266460 3300049742 Bacteria 1560
161 Ga0501080_0471565 3300049742 Bacteria 1124
162 Ga0501035_0025330 3300049822 Bacteria 5438
163 Ga0501035_0353693 3300049822 Bacteria 1229
164 Ga0501044_0023167 3300049823 Bacteria 6608
165 Ga0501044_0110299 3300049823 Bacteria 2760
166 Ga0501044_0463578 3300049823 Bacteria 1172
167 Ga0500559_0002838 3300053136 Bacteria 8752
168 Ga0500568_0023848 3300053139 Bacteria 2597
169 Ga0500622_0013462 3300053156 Bacteria 4413
170 Ga0500622_0032100 3300053156 Bacteria 2753
171 Ga0500622_0182226 3300053156 Bacteria 969
172 2896254106 2896253425 Bacteria 3418029
173 3003004224 3002998708 Bacteria 11715108
174 8047712836 8047710418 Bacteria 11023148
175 Ga0501044_0111025
176 JGI25406J46586_10010517
177 Ga0055525_1000046
178 Ga0070658_10033184
179 Ga0070676_10214389
180 Ga0070670_100000817
181 Ga0068869_100145810
182 Ga0068868_100349685
183 Ga0070660_100465182
184 Ga0070687_100253174
185 Ga0070661_100157013
186 Ga0070668_100085064
187 Ga0070674_100203244
188 Ga0070673_100074347
189 Ga0070714_100023431
190 Ga0070714_100393171
191 Ga0070710_10000092
192 Ga0070700_100338264
193 Ga0070663_100295846
194 Ga0070678_100051990
195 Ga0070678_100285110
196 Ga0070662_100329315
197 Ga0068867_100084540
198 Ga0070685_10031408
199 Ga0070679_100064022
200 Ga0070679_100426109
201 Ga0068853_100047645
202 Ga0070672_100167528
203 Ga0068855_100469443
204 Ga0068854_100193326
205 Ga0070702_100001345
206 Ga0068852_100005822
207 Ga0068852_100044978
208 Ga0068852_100417572
209 Ga0068859_100358695
210 Ga0068860_100660261
211 Ga0081539_10003461
212 Ga0070717_10003753
213 Ga0070717_10550777
214 Ga0097620_100358701
215 Ga0105240_10103575
216 Ga0105243_10190888
217 Ga0105241_10125059
218 Ga0105241_10229745
219 Ga0105238_10370678
220 Ga0105249_10187747
221 Ga0157371_10059409
222 Ga0157370_10088978
223 Ga0157374_10530475
224 Ga0157378_10574612
225 Ga0157372_10057863
226 Ga0157380_10141268
227 Ga0163161_10126814
228 Ga0213872_10000161
229 Ga0209563_100005
230 Ga0207692_10003880
231 Ga0207642_10137627
232 Ga0207710_10283469
233 Ga0207645_10083579
234 Ga0207705_10149993
235 Ga0207654_10306980
236 Ga0207707_10222337
237 Ga0207695_10233423
238 Ga0207662_10026993
239 Ga0207657_10055543
240 Ga0207657_10057369
241 Ga0207649_10535776
242 Ga0207652_10219919
243 Ga0207664_10002450
244 Ga0207690_10085583
245 Ga0207689_10092936
246 Ga0207667_10005402
247 Ga0207667_10264079
248 Ga0207640_10027214
249 Ga0207640_10280583
250 Ga0207702_10092072
251 Ga0207702_10362598
252 Ga0207683_10078137
253 Ga0207698_10100351
254 Ga0207698_10108757
255 Ga0207698_10203157
256 Ga0268264_10772003
257 Ga0307515_10157547
258 Ga0316177_1145330
259 Ga0316176_1106977
260 Ga0314311_1180204
261 Ga0307513_10023992
262 Ga0307509_10174458
263 Ga0307410_10056722
264 Ga0307409_100621559
265 Ga0307416_100225496
266 Ga0307507_10007741
267 Ga0307507_10081169
268 Ga0316574_0028755
269 Ga0395899_0037811
270 Ga0395898_0236907
271 Ga0395898_0242036
272 Ga0395905_0000479
273 Ga0395905_0022606
274 Ga0395905_0086188
275 Ga0395905_0168062
276 Ga0395901_0147415
277 Ga0395901_0238824
278 Ga0400483_015376
279 Ga0400483_191564
280 Ga0436361_0481133
281 Ga0466969_0078734
282 Ga0466972_0023268
283 Ga0466965_0003804
284 Ga0466965_0041314
285 Ga0466961_0139701
286 Ga0466964_0200347
287 Ga0466968_0191663
288 Ga0466959_0059855
289 Ga0466958_0509221
290 Ga0466967_0010170
291 Ga0466967_0735790
292 Ga0495592_0361193
293 Ga0495652_0156074
294 Ga0495598_0025927
295 Ga0495621_0006660
296 Ga0495604_0233798
297 Ga0495686_0002942
298 Ga0495686_0015338
299 Ga0496102_0067908
300 Ga0496102_0296228
301 Ga0496103_0286355
302 Ga0496106_0216984
303 Ga0496108_0089440
304 Ga0496109_0251057
305 Ga0496114_0386715
306 Ga0496122_0000092
307 Ga0496123_0000089
308 Ga0501031_0014598
309 Ga0501032_0029630
310 Ga0501033_0028790
311 Ga0501033_0075665
312 Ga0501033_0231048
313 Ga0501034_0029431
314 Ga0501034_0101624
315 Ga0501034_0305917
316 Ga0501036_0006365
317 Ga0501036_0084045
318 Ga0501037_0009930
319 Ga0501037_0037205
320 Ga0501038_0049588
321 Ga0501038_0091003
322 Ga0501042_0006123
323 Ga0501043_0028494
324 Ga0501043_0414772
325 Ga0501046_0245540
326 Ga0501047_0006134
327 Ga0501047_0018933
328 Ga0501047_0041534
329 Ga0501048_0035771
330 Ga0501067_0004865
331 Ga0501069_0049043
332 Ga0501070_0048542
333 Ga0501074_0015300
334 Ga0501080_0266460
335 Ga0501080_0471565
336 Ga0501035_0025330
337 Ga0501035_0353693
338 Ga0501044_0023167
339 Ga0501044_0110299
340 Ga0501044_0463578
341 Ga0500559_0002838
342 Ga0500568_0023848
343 Ga0500622_0013462
344 Ga0500622_0032100
345 Ga0500622_0182226
346 2896254106
347 3003004224
348 8047712836

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

53

249

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

59

286

0.87

PF08659

KR

KR domain

53

224

0.81

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

55

276

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dyv-assembly1.cif.gz_A crystal structure of a short-chain dehydrogenase/reductase sdr from xanthobacter autotrophicus py2 0.9691 7 242
4dry-assembly1.cif.gz_D the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti 0.9591 7 250
4dyv-assembly1.cif.gz_A crystal structure of a short-chain dehydrogenase/reductase sdr from xanthobacter autotrophicus py2 0.9557 7 242
4dry-assembly1.cif.gz_A the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti 0.9524 7 250
4dry-assembly1.cif.gz_A the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti 0.9447 7 250
ID Description Score Start End Superfamily
4dyvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9677 7 241 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9653 5 182 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9566 7 182 3.40.50.720
4dyvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.954 7 241 3.40.50.720
4dryA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9467 7 250 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3C0Y7A3-F1-model_v4 3-oxoacyl-ACP reductase 0.9894 79 230 GO:0016491
AF-A0A1J8QBZ6-F1-model_v4 NAD(P)-binding protein 0.9874 19 186 GO:0016491
AF-A0A382N0H9-F1-model_v4 3-oxoacyl-ACP reductase 0.9861 5 221 GO:0016491
AF-A0A0R2TTS8-F1-model_v4 3-oxoacyl-ACP reductase 0.9834 4 186 GO:0016491
AF-A0A246UB50-F1-model_v4 3-oxoacyl-ACP reductase 0.9804 5 250

Map