F264834

General Info

Members Datasets Scaffolds Average Seq Length
174 158 348 201

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10114910|Ga0307405_101149102
Length 236
Sequence MPDKPFSPACERNREPILTVLRRHFADRRHVLEIGSGTGQHAVHFAAAMPWLTWQCSDRAEHLPGIRQWLDGAALPNTPLPAGEGWGEGARKDACDANGGPACPHPPSGHLLPQAGEGRTGSGVVAARFDAAFSANTLHIMGWAEVEAFFAGLDSTLADNATLVVYGPFNYGGAYTSDSNREFDGWLRARDPRSGIRDFEAVDALAHAIGLHLVDDVAMPANNRCLVWRRDRPKHR

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
50 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
78 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
79 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
86 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
87 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
90 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
91 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
92 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
93 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
94 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
95 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
96 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
97 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
98 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
99 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
100 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
101 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
102 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
105 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
106 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
143 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
144 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
145 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
146 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
147 2643221559 Lysobacter sp. Root559 Isolate Unclassified
148 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
149 2643221573 Lysobacter sp. Root604 Isolate Unclassified
150 2643221586 Lysobacter sp. Root667 Isolate Unclassified
151 2643221593 Lysobacter sp. Root690 Isolate Unclassified
152 2643221612 Lysobacter sp. Root76 Isolate Unclassified
153 2643221720 Lysobacter sp. Root916 Isolate Unclassified
154 2643221727 Lysobacter sp. Root96 Isolate Unclassified
155 2643221728 Lysobacter sp. Root983 Isolate Unclassified
156 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
157 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
158 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.38
Metatranscriptomes 0.57
Isolates 8.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.07
Nodule 0
Rhizoplane 5.17
Rhizosphere 68.39
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10114910 3300031731 Bacteria 1830
2 JGI25162J39368_1000542 3300002737 Bacteria 28083
3 JGI25150J39212_1008556 3300002774 Bacteria 1996
4 JGI25151J46595_10000127 3300003187 Bacteria 102790
5 Ga0055526_1000012 3300003771 Bacteria 234368
6 Ga0055537_1000234 3300003773 Bacteria 40581
7 Ga0055524_1000037 3300003775 Bacteria 167140
8 Ga0055534_1000006 3300003784 Bacteria 234368
9 Ga0055528_1000006 3300003790 Bacteria 234368
10 Ga0070670_100035230 3300005331 Bacteria 4310
11 Ga0070666_10024227 3300005335 Bacteria 3952
12 Ga0070680_100194371 3300005336 Bacteria 1710
13 Ga0070682_100001784 3300005337 Bacteria 12006
14 Ga0070682_100739620 3300005337 Bacteria 793
15 Ga0070668_100080062 3300005347 Bacteria 2559
16 Ga0070669_100118807 3300005353 Bacteria 2014
17 Ga0070675_100211035 3300005354 Bacteria 1688
18 Ga0070671_100490958 3300005355 Bacteria 1056
19 Ga0068867_100077579 3300005459 Bacteria 2497
20 Ga0070679_100274853 3300005530 Bacteria 1638
21 Ga0070679_100391447 3300005530 Bacteria 1336
22 Ga0070672_100038841 3300005543 Bacteria 3641
23 Ga0070665_100156775 3300005548 Bacteria 2278
24 Ga0070664_100606432 3300005564 Bacteria 1015
25 Ga0070702_100051390 3300005615 Bacteria 2359
26 Ga0068852_101118797 3300005616 Bacteria 808
27 Ga0068859_100026480 3300005617 Bacteria 5816
28 Ga0068864_100114350 3300005618 Bacteria 2406
29 Ga0068861_100065044 3300005719 Bacteria 2807
30 Ga0068870_10019510 3300005840 Bacteria 3289
31 Ga0068860_100010825 3300005843 Bacteria 9004
32 Ga0075364_10027094 3300006051 Bacteria 3659
33 Ga0075428_100322229 3300006844 Bacteria 1661
34 Ga0075431_100056489 3300006847 Bacteria 4048
35 Ga0075429_100294599 3300006880 Bacteria 1421
36 Ga0097620_100026482 3300006931 Bacteria 5816
37 Ga0105243_10194732 3300009148 Bacteria 1773
38 Ga0105241_10302233 3300009174 Bacteria 1374
39 Ga0105238_10324362 3300009551 Bacteria 1526
40 Ga0105239_10588886 3300010375 Unclassified 1268
41 Ga0157373_10172663 3300013100 Bacteria 1521
42 Ga0157371_10023306 3300013102 Bacteria 4526
43 Ga0157369_10115226 3300013105 Bacteria 2854
44 Ga0157369_10335789 3300013105 Bacteria 1570
45 Ga0157372_10225675 3300013307 Bacteria 2171
46 Ga0157372_11201172 3300013307 Bacteria 876
47 Ga0157375_10093386 3300013308 Bacteria 3074
48 Ga0157380_11145903 3300014326 Bacteria 819
49 Ga0157377_10000589 3300014745 Bacteria 15115
50 Ga0183360_10002 3300015689 Bacteria 953821
51 Ga0163161_10022402 3300017792 Bacteria 4449
52 Ga0163161_10544577 3300017792 Bacteria 950
53 Ga0206353_10557298 3300020082 Bacteria 3164
54 Ga0207425_1003999 3300025245 Bacteria 4532
55 Ga0209565_1000002 3300025263 Bacteria 1423083
56 Ga0209565_1006790 3300025263 Bacteria 3167
57 Ga0209673_1000002 3300025273 Bacteria 1423083
58 Ga0209675_1000002 3300025291 Bacteria 1423083
59 Ga0209025_1000021 3300025294 Bacteria 593083
60 Ga0209564_1000004 3300025295 Bacteria 1424639
61 Ga0209758_1017783 3300025297 Bacteria 3517
62 Ga0209256_1000004 3300025299 Bacteria 1424643
63 Ga0207680_10015031 3300025903 Bacteria 4028
64 Ga0207705_10370435 3300025909 Bacteria 1105
65 Ga0207654_10065025 3300025911 Bacteria 2146
66 Ga0207657_10095589 3300025919 Bacteria 2472
67 Ga0207657_10140141 3300025919 Bacteria 1976
68 Ga0207652_10068493 3300025921 Bacteria 3080
69 Ga0207681_10184081 3300025923 Bacteria 1593
70 Ga0207650_10312560 3300025925 Bacteria 1285
71 Ga0207700_10372870 3300025928 Bacteria 1246
72 Ga0207644_10288260 3300025931 Bacteria 1320
73 Ga0207706_10150556 3300025933 Bacteria 2046
74 Ga0207709_10186566 3300025935 Bacteria 1469
75 Ga0207669_10050440 3300025937 Bacteria 2488
76 Ga0207691_10143460 3300025940 Bacteria 2103
77 Ga0207679_10180748 3300025945 Bacteria 1745
78 Ga0207679_10558611 3300025945 Bacteria 1028
79 Ga0207678_10009457 3300026067 Bacteria 8574
80 Ga0207648_10178940 3300026089 Bacteria 1876
81 Ga0207675_100042990 3300026118 Bacteria 4219
82 Ga0268266_10040468 3300028379 Bacteria 3973
83 Ga0268266_10225647 3300028379 Bacteria 1723
84 Ga0307515_10000381 3300028794 Bacteria 108373
85 Ga0307515_10155794 3300028794 Bacteria 2358
86 Ga0307513_10056386 3300031456 Bacteria 4195
87 Ga0307509_10007856 3300031507 Bacteria 13793
88 Ga0307509_10045160 3300031507 Bacteria 4755
89 Ga0307508_10007331 3300031616 Bacteria 10271
90 Ga0307514_10009526 3300031649 Bacteria 8160
91 Ga0307406_10675804 3300031901 Bacteria 860
92 Ga0307407_10076337 3300031903 Bacteria 2012
93 Ga0307412_10040481 3300031911 Bacteria 3015
94 Ga0307412_10051972 3300031911 Bacteria 2711
95 Ga0307412_10521909 3300031911 Bacteria 992
96 Ga0307414_10067646 3300032004 Bacteria 2560
97 Ga0307414_10936800 3300032004 Bacteria 795
98 Ga0307411_10209676 3300032005 Bacteria 1503
99 Ga0307507_10153934 3300033179 Bacteria 1720
100 Ga0373938_0033727 3300034957 Bacteria 1109
101 Ga0316574_0097206 3300035398 Bacteria 1882
102 Ga0395905_0099257 3300037471 Bacteria 2735
103 Ga0436360_0102030 3300039438 Bacteria 9249
104 Ga0436361_0994848 3300039447 Bacteria 946
105 Ga0439436_0021843 3300041404 Bacteria 1898
106 Ga0439461_0070171 3300041410 Bacteria 811
107 Ga0451797_0409989 3300041453 Bacteria 2048
108 Ga0451802_0983487 3300041460 Bacteria 4472
109 Ga0451833_1242043 3300041491 Bacteria 1240
110 Ga0451837_0537245 3300041494 Bacteria 616
111 Ga0451845_0917378 3300041501 Bacteria 1539
112 Ga0451855_0115407 3300041511 Bacteria 875
113 Ga0439445_0007152 3300042004 Bacteria 2582
114 Ga0439432_047304 3300042006 Bacteria 1350
115 Ga0439449_0043913 3300042007 Bacteria 1658
116 Ga0439449_0058346 3300042007 Bacteria 1425
117 Ga0439462_0039073 3300042015 Bacteria 1264
118 Ga0451576_0470823 3300045051 Bacteria 1319
119 Ga0495598_0013366 3300046537 Bacteria 2033
120 Ga0495621_0019647 3300046539 Bacteria 2208
121 Ga0495611_0135649 3300046648 Bacteria 1149
122 Ga0495625_0114827 3300046660 Bacteria 1838
123 Ga0495658_0085231 3300046683 Bacteria 1862
124 Ga0495671_0021098 3300046692 Bacteria 3426
125 Ga0496102_0656874 3300048905 Bacteria 972
126 Ga0496105_0556325 3300048908 Bacteria 895
127 Ga0496106_0578026 3300048909 Unclassified 901
128 Ga0496108_0933033 3300048911 Bacteria 744
129 Ga0496110_0175818 3300048913 Bacteria 1943
130 Ga0496113_0057052 3300048916 Bacteria 2933
131 Ga0496114_0113922 3300048917 Bacteria 2318
132 Ga0496121_0000700 3300048924 Bacteria 62395
133 Ga0496126_0041137 3300048929 Bacteria 4280
134 Ga0501031_0001075 3300049568 Bacteria 16605
135 Ga0501031_0364570 3300049568 Bacteria 935
136 Ga0501032_0004521 3300049569 Bacteria 10462
137 Ga0501033_0001833 3300049570 Bacteria 18518
138 Ga0501034_0002128 3300049571 Bacteria 24607
139 Ga0501036_0018006 3300049572 Bacteria 5914
140 Ga0501037_0022998 3300049573 Bacteria 4609
141 Ga0501038_0001637 3300049574 Bacteria 20832
142 Ga0501043_0003993 3300049579 Bacteria 12074
143 Ga0501046_0002364 3300049580 Bacteria 17748
144 Ga0501047_0001182 3300049581 Bacteria 25866
145 Ga0501048_0009343 3300049582 Bacteria 7363
146 Ga0501067_0106383 3300049583 Bacteria 1559
147 Ga0501068_0143632 3300049584 Bacteria 1497
148 Ga0501070_0199744 3300049586 Bacteria 1642
149 Ga0501072_0398456 3300049588 Bacteria 1092
150 Ga0501073_0002855 3300049589 Bacteria 12945
151 Ga0501074_0186564 3300049590 Bacteria 1479
152 Ga0501080_0040359 3300049742 Bacteria 4353
153 Ga0501035_0005069 3300049822 Bacteria 12484
154 Ga0501044_0717044 3300049823 Bacteria 884
155 nmdc:mga09592_134956_c1 3300050508 Bacteria 2125
156 nmdc:mga0qj67_143634_c1 3300050509 Bacteria 1935
157 nmdc:mga06r32_176404_c1 3300050510 Bacteria 2122
158 Ga0500583_0202217 3300053092 Bacteria 987
159 Ga0500593_001812 3300053117 Bacteria 7673
160 Ga0500622_0011516 3300053156 Bacteria 4814
161 2538835107 2537561836 Bacteria 3910579
162 2572255565 2571042365 Bacteria 3289345
163 2643817250 2643221559 Bacteria 4424915
164 2643829008 2643221562 Bacteria 4048635
165 2643879856 2643221573 Bacteria 4784121
166 2643939750 2643221586 Bacteria 4446529
167 2643975172 2643221593 Bacteria 6296053
168 2644078278 2643221612 Bacteria 4361984
169 2644662595 2643221720 Bacteria 4694283
170 2644696724 2643221727 Bacteria 4415595
171 2644701172 2643221728 Bacteria 4797149
172 2923516804 2923516293 Bacteria 3716336
173 2941492131 2941489479 Bacteria 6313767
174 2995953970 2995948881 Bacteria 6358104
175 Ga0307405_10114910
176 JGI25162J39368_1000542
177 JGI25150J39212_1008556
178 JGI25151J46595_10000127
179 Ga0055526_1000012
180 Ga0055537_1000234
181 Ga0055524_1000037
182 Ga0055534_1000006
183 Ga0055528_1000006
184 Ga0070670_100035230
185 Ga0070666_10024227
186 Ga0070680_100194371
187 Ga0070682_100001784
188 Ga0070682_100739620
189 Ga0070668_100080062
190 Ga0070669_100118807
191 Ga0070675_100211035
192 Ga0070671_100490958
193 Ga0068867_100077579
194 Ga0070679_100274853
195 Ga0070679_100391447
196 Ga0070672_100038841
197 Ga0070665_100156775
198 Ga0070664_100606432
199 Ga0070702_100051390
200 Ga0068852_101118797
201 Ga0068859_100026480
202 Ga0068864_100114350
203 Ga0068861_100065044
204 Ga0068870_10019510
205 Ga0068860_100010825
206 Ga0075364_10027094
207 Ga0075428_100322229
208 Ga0075431_100056489
209 Ga0075429_100294599
210 Ga0097620_100026482
211 Ga0105243_10194732
212 Ga0105241_10302233
213 Ga0105238_10324362
214 Ga0105239_10588886
215 Ga0157373_10172663
216 Ga0157371_10023306
217 Ga0157369_10115226
218 Ga0157369_10335789
219 Ga0157372_10225675
220 Ga0157372_11201172
221 Ga0157375_10093386
222 Ga0157380_11145903
223 Ga0157377_10000589
224 Ga0183360_10002
225 Ga0163161_10022402
226 Ga0163161_10544577
227 Ga0206353_10557298
228 Ga0207425_1003999
229 Ga0209565_1000002
230 Ga0209565_1006790
231 Ga0209673_1000002
232 Ga0209675_1000002
233 Ga0209025_1000021
234 Ga0209564_1000004
235 Ga0209758_1017783
236 Ga0209256_1000004
237 Ga0207680_10015031
238 Ga0207705_10370435
239 Ga0207654_10065025
240 Ga0207657_10095589
241 Ga0207657_10140141
242 Ga0207652_10068493
243 Ga0207681_10184081
244 Ga0207650_10312560
245 Ga0207700_10372870
246 Ga0207644_10288260
247 Ga0207706_10150556
248 Ga0207709_10186566
249 Ga0207669_10050440
250 Ga0207691_10143460
251 Ga0207679_10180748
252 Ga0207679_10558611
253 Ga0207678_10009457
254 Ga0207648_10178940
255 Ga0207675_100042990
256 Ga0268266_10040468
257 Ga0268266_10225647
258 Ga0307515_10000381
259 Ga0307515_10155794
260 Ga0307513_10056386
261 Ga0307509_10007856
262 Ga0307509_10045160
263 Ga0307508_10007331
264 Ga0307514_10009526
265 Ga0307406_10675804
266 Ga0307407_10076337
267 Ga0307412_10040481
268 Ga0307412_10051972
269 Ga0307412_10521909
270 Ga0307414_10067646
271 Ga0307414_10936800
272 Ga0307411_10209676
273 Ga0307507_10153934
274 Ga0373938_0033727
275 Ga0316574_0097206
276 Ga0395905_0099257
277 Ga0436360_0102030
278 Ga0436361_0994848
279 Ga0439436_0021843
280 Ga0439461_0070171
281 Ga0451797_0409989
282 Ga0451802_0983487
283 Ga0451833_1242043
284 Ga0451837_0537245
285 Ga0451845_0917378
286 Ga0451855_0115407
287 Ga0439445_0007152
288 Ga0439432_047304
289 Ga0439449_0043913
290 Ga0439449_0058346
291 Ga0439462_0039073
292 Ga0451576_0470823
293 Ga0495598_0013366
294 Ga0495621_0019647
295 Ga0495611_0135649
296 Ga0495625_0114827
297 Ga0495658_0085231
298 Ga0495671_0021098
299 Ga0496102_0656874
300 Ga0496105_0556325
301 Ga0496106_0578026
302 Ga0496108_0933033
303 Ga0496110_0175818
304 Ga0496113_0057052
305 Ga0496114_0113922
306 Ga0496121_0000700
307 Ga0496126_0041137
308 Ga0501031_0001075
309 Ga0501031_0364570
310 Ga0501032_0004521
311 Ga0501033_0001833
312 Ga0501034_0002128
313 Ga0501036_0018006
314 Ga0501037_0022998
315 Ga0501038_0001637
316 Ga0501043_0003993
317 Ga0501046_0002364
318 Ga0501047_0001182
319 Ga0501048_0009343
320 Ga0501067_0106383
321 Ga0501068_0143632
322 Ga0501070_0199744
323 Ga0501072_0398456
324 Ga0501073_0002855
325 Ga0501074_0186564
326 Ga0501080_0040359
327 Ga0501035_0005069
328 Ga0501044_0717044
329 nmdc:mga09592_134956_c1
330 nmdc:mga0qj67_143634_c1
331 nmdc:mga06r32_176404_c1
332 Ga0500583_0202217
333 Ga0500593_001812
334 Ga0500622_0011516
335 2538835107
336 2572255565
337 2643817250
338 2643829008
339 2643879856
340 2643939750
341 2643975172
342 2644078278
343 2644662595
344 2644696724
345 2644701172
346 2923516804
347 2941492131
348 2995953970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06080

DUF938

Protein of unknown function (DUF938)

4

84

0.97

PF06080

DUF938

Protein of unknown function (DUF938)

112

230

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tji-assembly1.cif.gz_A sam-dependent methyltransferase redm, apo 0.9042 8 194
8tjj-assembly2.cif.gz_B sam-dependent methyltransferase redm bound to sam 0.9039 8 194
8tjk-assembly1.cif.gz_B sam-dependent methyltransferase redm bound to sah 0.9012 11 194
8tjj-assembly1.cif.gz_D sam-dependent methyltransferase redm bound to sam 0.8995 8 194
8tjj-assembly1.cif.gz_A sam-dependent methyltransferase redm bound to sam 0.8991 8 194
ID Description Score Start End Superfamily
af_Q7ZVJ8_3_201_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9366 5 193 3.40.50.150
af_Q7YWR7_1_204_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9317 4 194 3.40.50.150
af_Q66I74_7_186_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.926 10 174 3.40.50.150
af_Q9VLF6_13_218_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9131 2 190 3.40.50.150
af_Q7YWR7_1_204_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9001 4 194 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6N6L953-F1-model_v4 DUF938 domain-containing protein 0.9929 1 194
AF-A0A167BHF3-F1-model_v4 Methylase 0.9839 1 194
AF-A0A2T6NEV4-F1-model_v4 Methylase 0.9826 3 195 GO:0008168
GO:0032259
AF-A0A2E6H519-F1-model_v4 Methylase 0.9779 1 194 GO:0008168
GO:0032259
AF-A0A6N6L953-F1-model_v4 DUF938 domain-containing protein 0.9778 1 194

Map