F264507

General Info

Members Datasets Scaffolds Average Seq Length
174 106 348 209

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10208425|Ga0105241_102084252
Length 241
Sequence LAACQWESDILTPFAPGKNLSYLPGEMQTLVHEFIPAQDKTSRHLWIMLHGLGDSIEGYRWLPETMQLPWMNYLLVNAPDEYYGGYSWYNFAGDLSDIVPGVERSRKLLFQLLDAQRAAGFPTEQTTLGGFSQGCLMSLDVGLRYPHRFAGIVGVSGYVCEPERLVKELSPVAKQQRILVTHGTKDTMVPFAKARPQMQMLEDAGVNLQFRAFEKAHTLAGEEEINLIREFVRAGYAVVGQ

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
72 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
89 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
96 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
97 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
98 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
99 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
100 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
101 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
102 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
103 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
104 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
105 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
106 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.57
Rhizosphere 98.85
Stem 0
Stem Tuber 0
Unclassified 33.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10208425 3300009174 Bacteria 1636
2 rootH2_10193392 3300003320 Unclassified 4601
3 Ga0065712_10217976 3300005290 Unclassified 1050
4 Ga0065715_10213924 3300005293 Unclassified 1301
5 Ga0065707_10321982 3300005295 Unclassified 965
6 Ga0070690_100004247 3300005330 Bacteria 7933
7 Ga0070690_100255094 3300005330 Bacteria 1242
8 Ga0070690_100299818 3300005330 Unclassified 1152
9 Ga0070666_10027260 3300005335 Bacteria 3740
10 Ga0068868_100144625 3300005338 Bacteria 1954
11 Ga0068868_100312460 3300005338 Unclassified 1337
12 Ga0070689_100008087 3300005340 Bacteria 7390
13 Ga0070689_100087312 3300005340 Bacteria 2454
14 Ga0070691_10174372 3300005341 Bacteria 1116
15 Ga0070669_100791705 3300005353 Unclassified 805
16 Ga0070688_100015570 3300005365 Bacteria 4332
17 Ga0070688_100217110 3300005365 Unclassified 1346
18 Ga0070714_100147820 3300005435 Unclassified 2115
19 Ga0070705_100345417 3300005440 Bacteria 1083
20 Ga0070694_100002624 3300005444 Bacteria 10629
21 Ga0070708_100718823 3300005445 Unclassified 940
22 Ga0070685_10260184 3300005466 Bacteria 1153
23 Ga0070707_100603722 3300005468 Unclassified 1060
24 Ga0070697_100674687 3300005536 Unclassified 911
25 Ga0070695_100181881 3300005545 Bacteria 1490
26 Ga0068855_100093274 3300005563 Bacteria 3472
27 Ga0068855_100205008 3300005563 Unclassified 2219
28 Ga0068855_100398036 3300005563 Bacteria 1509
29 Ga0068856_100030235 3300005614 Bacteria 5295
30 Ga0068856_100046160 3300005614 Bacteria 4291
31 Ga0068859_100542062 3300005617 Unclassified 1258
32 Ga0068859_100828900 3300005617 Bacteria 1012
33 Ga0068858_100427129 3300005842 Unclassified 1275
34 Ga0070715_10060992 3300006163 Bacteria 1655
35 Ga0070716_100343861 3300006173 Unclassified 1053
36 Ga0097621_100228951 3300006237 Unclassified 1622
37 Ga0097621_100320223 3300006237 Bacteria 1373
38 Ga0097621_100777758 3300006237 Unclassified 886
39 Ga0068871_100277604 3300006358 Unclassified 1465
40 Ga0075428_100003008 3300006844 Bacteria 18404
41 Ga0075428_100140532 3300006844 Unclassified 2625
42 Ga0075430_100084442 3300006846 Bacteria 2659
43 Ga0075431_100068583 3300006847 Bacteria 3660
44 Ga0075431_100086635 3300006847 Bacteria 3232
45 Ga0075434_100316181 3300006871 Bacteria 1582
46 Ga0075429_100096701 3300006880 Bacteria 2576
47 Ga0097620_100541973 3300006931 Unclassified 1258
48 Ga0097620_100828893 3300006931 Bacteria 1012
49 Ga0099794_10269126 3300007265 Unclassified 880
50 Ga0105240_10068190 3300009093 Bacteria 4406
51 Ga0105240_10205013 3300009093 Bacteria 2309
52 Ga0105240_10366497 3300009093 Bacteria 1630
53 Ga0111539_10002005 3300009094 Bacteria 27177
54 Ga0111539_10156795 3300009094 Bacteria 2664
55 Ga0111539_10299574 3300009094 Bacteria 1871
56 Ga0111539_10382194 3300009094 Unclassified 1639
57 Ga0111539_10695377 3300009094 Unclassified 1184
58 Ga0105245_10006810 3300009098 Bacteria 10025
59 Ga0114129_12053265 3300009147 Unclassified 690
60 Ga0105242_10208633 3300009176 Bacteria 1739
61 Ga0105238_10001693 3300009551 Bacteria 22183
62 Ga0105249_10325641 3300009553 Bacteria 1549
63 Ga0105249_10758233 3300009553 Bacteria 1033
64 Ga0157370_10031703 3300013104 Bacteria 5168
65 Ga0157378_10254269 3300013297 Unclassified 1683
66 Ga0157378_10444666 3300013297 Bacteria 1285
67 Ga0157372_10047722 3300013307 Bacteria 4760
68 Ga0157372_10463527 3300013307 Bacteria 1477
69 Ga0157375_10000494 3300013308 Bacteria 35751
70 Ga0163163_10000059 3300014325 Bacteria 123393
71 Ga0163163_10212481 3300014325 Bacteria 1984
72 Ga0157379_10365389 3300014968 Unclassified 1323
73 Ga0157376_11204076 3300014969 Unclassified 786
74 Ga0207680_10283779 3300025903 Unclassified 1151
75 Ga0207707_10152837 3300025912 Bacteria 2018
76 Ga0207695_10131773 3300025913 Bacteria 2457
77 Ga0207695_10320151 3300025913 Unclassified 1440
78 Ga0207693_10412699 3300025915 Bacteria 1055
79 Ga0207694_10013362 3300025924 Bacteria 6183
80 Ga0207700_10480548 3300025928 Unclassified 1098
81 Ga0207664_10123037 3300025929 Unclassified 2174
82 Ga0207670_10036062 3300025936 Bacteria 3213
83 Ga0207667_10049808 3300025949 Bacteria 4422
84 Ga0207712_10515389 3300025961 Bacteria 1024
85 Ga0207677_10183784 3300026023 Bacteria 1647
86 Ga0207702_10022631 3300026078 Bacteria 5212
87 Ga0265326_10019695 3300028558 Bacteria 1938
88 Ga0265338_10000062 3300028800 Bacteria 196060
89 Ga0265338_10000283 3300028800 Bacteria 91383
90 Ga0265338_10009042 3300028800 Bacteria 11981
91 Ga0265338_10017075 3300028800 Bacteria 7844
92 Ga0265338_10033602 3300028800 Bacteria 4973
93 Ga0265338_10072652 3300028800 Bacteria 2936
94 Ga0265338_10262501 3300028800 Bacteria 1269
95 Ga0265338_10410685 3300028800 Unclassified 964
96 Ga0265324_10000199 3300029957 Bacteria 45762
97 Ga0265324_10017852 3300029957 Unclassified 2577
98 Ga0265324_10030880 3300029957 Unclassified 1878
99 Ga0265324_10036230 3300029957 Bacteria 1716
100 Ga0265328_10037478 3300031239 Unclassified 1791
101 Ga0265320_10006439 3300031240 Bacteria 7401
102 Ga0265339_10013365 3300031249 Unclassified 4977
103 Ga0265327_10039968 3300031251 Bacteria 2542
104 Ga0265327_10125001 3300031251 Bacteria 1215
105 Ga0265314_10000206 3300031711 Bacteria 87046
106 Ga0265314_10099932 3300031711 Unclassified 1867
107 Ga0265314_10216290 3300031711 Unclassified 1121
108 Ga0265342_10093260 3300031712 Unclassified 1724
109 Ga0373954_0011884 3300035118 Bacteria 3866
110 Ga0373954_0016725 3300035118 Unclassified 3287
111 Ga0373956_0317488 3300035119 Bacteria 742
112 Ga0373955_0133655 3300035172 Bacteria 1450
113 Ga0373937_0940606 3300036401 Unclassified 813
114 Ga0395905_0082814 3300037471 Unclassified 3006
115 Ga0395901_0833760 3300038443 Unclassified 909
116 Ga0451577_0004822 3300042876 Bacteria 14089
117 Ga0451577_0013932 3300042876 Bacteria 7505
118 Ga0451577_0107186 3300042876 Bacteria 2497
119 Ga0451577_0172702 3300042876 Bacteria 1948
120 Ga0451577_0759198 3300042876 Unclassified 877
121 Ga0453684_0000389 3300044712 Bacteria 180487
122 Ga0453684_0014373 3300044712 Bacteria 12678
123 Ga0453684_0726246 3300044712 Bacteria 1077
124 Ga0451576_0018379 3300045051 Bacteria 7665
125 Ga0451576_0138559 3300045051 Bacteria 2538
126 Ga0451576_0191492 3300045051 Unclassified 2136
127 Ga0451576_0194694 3300045051 Bacteria 2117
128 Ga0451576_0230550 3300045051 Bacteria 1934
129 Ga0451576_0395418 3300045051 Bacteria 1449
130 Ga0451576_0612793 3300045051 Bacteria 1144
131 Ga0451576_0790075 3300045051 Bacteria 997
132 Ga0451576_0955084 3300045051 Unclassified 899
133 Ga0495592_0000088 3300046454 Bacteria 81548
134 Ga0495651_0180993 3300046462 Bacteria 1492
135 Ga0495582_0199779 3300046473 Bacteria 1142
136 Ga0495662_0007660 3300046476 Bacteria 5326
137 Ga0495664_0019853 3300046477 Unclassified 3869
138 Ga0495618_0287025 3300046514 Bacteria 1025
139 Ga0495628_0001636 3300046516 Bacteria 20509
140 Ga0495628_0084623 3300046516 Bacteria 2461
141 Ga0495630_0013848 3300046517 Bacteria 5866
142 Ga0495630_0141265 3300046517 Bacteria 1831
143 Ga0495630_0783064 3300046517 Unclassified 728
144 Ga0495666_0033610 3300046526 Bacteria 2505
145 Ga0495666_0163538 3300046526 Bacteria 1031
146 Ga0495642_0351310 3300046528 Unclassified 648
147 Ga0495586_0000043 3300046535 Bacteria 74540
148 Ga0495586_0000233 3300046535 Bacteria 36840
149 Ga0495645_0056427 3300046543 Unclassified 2852
150 Ga0495645_0243293 3300046543 Bacteria 1199
151 Ga0495634_0033192 3300046642 Bacteria 3547
152 Ga0495634_0070173 3300046642 Unclassified 2310
153 Ga0495635_0471245 3300046663 Bacteria 829
154 Ga0495599_0003002 3300046678 Bacteria 9830
155 Ga0495624_0212170 3300046690 Unclassified 1174
156 Ga0495581_0109211 3300047315 Unclassified 1608
157 Ga0495581_0159404 3300047315 Bacteria 1319
158 Ga0495674_0007012 3300047319 Bacteria 10781
159 Ga0495674_0014895 3300047319 Bacteria 7276
160 Ga0495674_0015186 3300047319 Bacteria 7202
161 Ga0495676_0015558 3300047321 Bacteria 6769
162 Ga0495684_0086493 3300047471 Bacteria 2376
163 Ga0496115_0004792 3300048918 Bacteria 9815
164 nmdc:mga09592_183726_c1 3300050508 Bacteria 1809
165 nmdc:mga0qj67_118164_c1 3300050509 Unclassified 2143
166 nmdc:mga0qj67_24142_c1 3300050509 Bacteria 4684
167 nmdc:mga06r32_110737_c2 3300050510 Bacteria 2336
168 nmdc:mga06r32_31489_c1 3300050510 Bacteria 4982
169 nmdc:mga08y16_160003_c1 3300050511 Bacteria 2339
170 nmdc:mga08y16_2114_c1 3300050511 Bacteria 20363
171 nmdc:mga08y16_457317_c1 3300050511 Unclassified 1301
172 nmdc:mga0rr50_572377_c1 3300050513 Unclassified 962
173 nmdc:mga0rr50_715649_c1 3300050513 Unclassified 854
174 nmdc:mga0a205_376987_c1 3300050515 Unclassified 1284
175 Ga0105241_10208425
176 rootH2_10193392
177 Ga0065712_10217976
178 Ga0065715_10213924
179 Ga0065707_10321982
180 Ga0070690_100004247
181 Ga0070690_100255094
182 Ga0070690_100299818
183 Ga0070666_10027260
184 Ga0068868_100144625
185 Ga0068868_100312460
186 Ga0070689_100008087
187 Ga0070689_100087312
188 Ga0070691_10174372
189 Ga0070669_100791705
190 Ga0070688_100015570
191 Ga0070688_100217110
192 Ga0070714_100147820
193 Ga0070705_100345417
194 Ga0070694_100002624
195 Ga0070708_100718823
196 Ga0070685_10260184
197 Ga0070707_100603722
198 Ga0070697_100674687
199 Ga0070695_100181881
200 Ga0068855_100093274
201 Ga0068855_100205008
202 Ga0068855_100398036
203 Ga0068856_100030235
204 Ga0068856_100046160
205 Ga0068859_100542062
206 Ga0068859_100828900
207 Ga0068858_100427129
208 Ga0070715_10060992
209 Ga0070716_100343861
210 Ga0097621_100228951
211 Ga0097621_100320223
212 Ga0097621_100777758
213 Ga0068871_100277604
214 Ga0075428_100003008
215 Ga0075428_100140532
216 Ga0075430_100084442
217 Ga0075431_100068583
218 Ga0075431_100086635
219 Ga0075434_100316181
220 Ga0075429_100096701
221 Ga0097620_100541973
222 Ga0097620_100828893
223 Ga0099794_10269126
224 Ga0105240_10068190
225 Ga0105240_10205013
226 Ga0105240_10366497
227 Ga0111539_10002005
228 Ga0111539_10156795
229 Ga0111539_10299574
230 Ga0111539_10382194
231 Ga0111539_10695377
232 Ga0105245_10006810
233 Ga0114129_12053265
234 Ga0105242_10208633
235 Ga0105238_10001693
236 Ga0105249_10325641
237 Ga0105249_10758233
238 Ga0157370_10031703
239 Ga0157378_10254269
240 Ga0157378_10444666
241 Ga0157372_10047722
242 Ga0157372_10463527
243 Ga0157375_10000494
244 Ga0163163_10000059
245 Ga0163163_10212481
246 Ga0157379_10365389
247 Ga0157376_11204076
248 Ga0207680_10283779
249 Ga0207707_10152837
250 Ga0207695_10131773
251 Ga0207695_10320151
252 Ga0207693_10412699
253 Ga0207694_10013362
254 Ga0207700_10480548
255 Ga0207664_10123037
256 Ga0207670_10036062
257 Ga0207667_10049808
258 Ga0207712_10515389
259 Ga0207677_10183784
260 Ga0207702_10022631
261 Ga0265326_10019695
262 Ga0265338_10000062
263 Ga0265338_10000283
264 Ga0265338_10009042
265 Ga0265338_10017075
266 Ga0265338_10033602
267 Ga0265338_10072652
268 Ga0265338_10262501
269 Ga0265338_10410685
270 Ga0265324_10000199
271 Ga0265324_10017852
272 Ga0265324_10030880
273 Ga0265324_10036230
274 Ga0265328_10037478
275 Ga0265320_10006439
276 Ga0265339_10013365
277 Ga0265327_10039968
278 Ga0265327_10125001
279 Ga0265314_10000206
280 Ga0265314_10099932
281 Ga0265314_10216290
282 Ga0265342_10093260
283 Ga0373954_0011884
284 Ga0373954_0016725
285 Ga0373956_0317488
286 Ga0373955_0133655
287 Ga0373937_0940606
288 Ga0395905_0082814
289 Ga0395901_0833760
290 Ga0451577_0004822
291 Ga0451577_0013932
292 Ga0451577_0107186
293 Ga0451577_0172702
294 Ga0451577_0759198
295 Ga0453684_0000389
296 Ga0453684_0014373
297 Ga0453684_0726246
298 Ga0451576_0018379
299 Ga0451576_0138559
300 Ga0451576_0191492
301 Ga0451576_0194694
302 Ga0451576_0230550
303 Ga0451576_0395418
304 Ga0451576_0612793
305 Ga0451576_0790075
306 Ga0451576_0955084
307 Ga0495592_0000088
308 Ga0495651_0180993
309 Ga0495582_0199779
310 Ga0495662_0007660
311 Ga0495664_0019853
312 Ga0495618_0287025
313 Ga0495628_0001636
314 Ga0495628_0084623
315 Ga0495630_0013848
316 Ga0495630_0141265
317 Ga0495630_0783064
318 Ga0495666_0033610
319 Ga0495666_0163538
320 Ga0495642_0351310
321 Ga0495586_0000043
322 Ga0495586_0000233
323 Ga0495645_0056427
324 Ga0495645_0243293
325 Ga0495634_0033192
326 Ga0495634_0070173
327 Ga0495635_0471245
328 Ga0495599_0003002
329 Ga0495624_0212170
330 Ga0495581_0109211
331 Ga0495581_0159404
332 Ga0495674_0007012
333 Ga0495674_0014895
334 Ga0495674_0015186
335 Ga0495676_0015558
336 Ga0495684_0086493
337 Ga0496115_0004792
338 nmdc:mga09592_183726_c1
339 nmdc:mga0qj67_118164_c1
340 nmdc:mga0qj67_24142_c1
341 nmdc:mga06r32_110737_c2
342 nmdc:mga06r32_31489_c1
343 nmdc:mga08y16_160003_c1
344 nmdc:mga08y16_2114_c1
345 nmdc:mga08y16_457317_c1
346 nmdc:mga0rr50_572377_c1
347 nmdc:mga0rr50_715649_c1
348 nmdc:mga0a205_376987_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02230

Abhydrolase_2

Phospholipase/Carboxylesterase

30

235

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ftw-assembly1.cif.gz_A-2 crystal structure of a carboxyl esterase n110c/l145h at 2.3 angstrom resolution 0.9205 2 204
4fhz-assembly1.cif.gz_A-2 crystal structure of a carboxyl esterase at 2.0 angstrom resolution 0.9178 2 203
6avv-assembly1.cif.gz_A crystal structure of arabidopsis thaliana sober1 0.9124 16 204
6avx-assembly1.cif.gz_A crystal structure of arabidopsis thaliana sober1 f65l 0.9082 17 204
5dwd-assembly1.cif.gz_A crystal structure of esterase pe8 0.9045 2 205
ID Description Score Start End Superfamily
4ftwA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9205 2 204 3.40.50.1820
af_O95372_1_231_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9171 4 208 3.40.50.1820
af_Q12354_5_226_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9126 7 206 3.40.50.1820
af_O42881_1_222_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9104 2 204 3.40.50.1820
af_Q5AGD1_2_230_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9098 1 203 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A538PD70-F1-model_v4 Serine esterase 0.9941 1 204 GO:0005737
GO:0008474
GO:0016020
GO:0052689
AF-A0A7V4IGX4-F1-model_v4 Phospholipase/carboxylesterase/thioesterase domain-containing protein 0.9932 2 204 GO:0016787
AF-A0A2V5Q416-F1-model_v4 Phospholipase/carboxylesterase/thioesterase domain-containing protein 0.9914 67 200 GO:0016787
AF-A0A382EHC9-F1-model_v4 Phospholipase/carboxylesterase/thioesterase domain-containing protein 0.9909 1 104 GO:0016787
AF-A0A832HRU5-F1-model_v4 Serine esterase 0.9903 1 206 GO:0016787

Map