F263661

General Info

Members Datasets Scaffolds Average Seq Length
174 122 171 307

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10007835|JGI24740J21852_100078354
Length 336
Sequence MKHRVEYRPLAGAHTPARSLSGPVEQSSLXXXGKDQPVADLSKKVIITCAVTGGIHTPTMSDALPFTPDDIARQSIEAAEAGASILHLHARDPKDGRPTPDPAVFMQFLPRIKQATDAVINVTTGGGLNMSVEQRLAAPLLAKGIYPLADRYSSWKYEWEXPYLRGTDDFIFRNTFRDIERILKLLGDGHGTRFEHECYDVGHLYSLAHFVDRGLVKPPFFVQMIFGILGGIGPDMDNLTFMKHKADKLFGSDYRWSVLAAGRFQMPFATQAAMLGGSVRVGLEDSLYIGRGKLAGSNAEQVRKIRAILTELGHEIATPAEARAILGLKGGDLVGF

Samples

Sample ID Description Type Environment
1 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
2 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
3 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
32 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
33 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
34 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
36 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
47 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
48 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
49 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
52 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
55 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
56 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
61 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
62 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
63 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
64 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
65 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
66 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
67 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
68 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
69 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
70 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
71 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
72 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
73 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
74 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
75 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
78 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
79 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
80 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
81 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
82 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
83 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
84 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
85 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
86 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
87 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
88 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
89 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
90 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
91 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
92 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
93 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
94 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
95 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
96 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
109 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
121 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
122 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 0
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.49
Nodule 0
Rhizoplane 4.6
Rhizosphere 75.86
Stem 0
Stem Tuber 0
Unclassified 8.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007835 3300001979 Bacteria 4310
2 JGI24739J22299_10048506 3300001989 Bacteria 1381
3 JGI25165J46597_1002053 3300003214 Bacteria 7573
4 Ga0055526_1000009 3300003771 Bacteria 257259
5 Ga0055524_1000404 3300003775 Bacteria 36829
6 Ga0055531_10044911 3300003794 Bacteria 1232
7 Ga0070658_10377241 3300005327 Bacteria 1216
8 Ga0070683_100294805 3300005329 Bacteria 1543
9 Ga0070660_100032030 3300005339 Bacteria 3953
10 Ga0070689_100170410 3300005340 Bacteria 1764
11 Ga0070694_100250134 3300005444 Bacteria 1340
12 Ga0070681_10000898 3300005458 Bacteria 25185
13 Ga0068853_100061113 3300005539 Bacteria 3258
14 Ga0070665_100000024 3300005548 Bacteria 374559
15 Ga0070665_100003920 3300005548 Bacteria 15711
16 Ga0070665_100081233 3300005548 Bacteria 3247
17 Ga0070665_100217029 3300005548 Bacteria 1913
18 Ga0068862_100001592 3300005844 Bacteria 20675
19 Ga0081455_10001669 3300005937 Bacteria 26910
20 Ga0075363_100020492 3300006048 Bacteria 3316
21 Ga0075364_10021987 3300006051 Bacteria 4024
22 Ga0075432_10022686 3300006058 Bacteria 2147
23 Ga0075435_100422151 3300007076 Bacteria 1149
24 Ga0105240_10000121 3300009093 Bacteria 163057
25 Ga0105240_10004073 3300009093 Bacteria 22482
26 Ga0105240_10010881 3300009093 Bacteria 12743
27 Ga0105240_10019395 3300009093 Bacteria 9086
28 Ga0105237_10085309 3300009545 Bacteria 3148
29 Ga0105238_10005328 3300009551 Bacteria 12707
30 Ga0105249_10023365 3300009553 Bacteria 5547
31 Ga0105239_10002865 3300010375 Bacteria 21566
32 Ga0157369_10201498 3300013105 Bacteria 2089
33 Ga0182008_10017412 3300014497 Bacteria 3728
34 Ga0182007_10002819 3300015262 Bacteria 8466
35 Ga0213872_10011556 3300021361 Bacteria 4175
36 Ga0209233_1000034 3300025261 Bacteria 578898
37 Ga0209564_1000069 3300025295 Bacteria 303332
38 Ga0209758_1000485 3300025297 Bacteria 65234
39 Ga0209257_1007906 3300025304 Bacteria 6250
40 Ga0209257_1010719 3300025304 Bacteria 4568
41 Ga0207647_10008002 3300025904 Bacteria 7602
42 Ga0207695_10002449 3300025913 Bacteria 27444
43 Ga0207695_10008639 3300025913 Bacteria 12717
44 Ga0207695_10176351 3300025913 Bacteria 2060
45 Ga0207663_10053042 3300025916 Bacteria 2532
46 Ga0207694_10011281 3300025924 Bacteria 6748
47 Ga0207667_10000393 3300025949 Bacteria 58962
48 Ga0207639_10023731 3300026041 Bacteria 4431
49 Ga0207674_10112161 3300026116 Bacteria 2701
50 Ga0268266_10000019 3300028379 Bacteria 556465
51 Ga0268266_10003820 3300028379 Bacteria 14738
52 Ga0268265_10084335 3300028380 Bacteria 2518
53 Ga0316575_10028386 3300031665 Bacteria 2182
54 Ga0307516_10000124 3300031730 Bacteria 90831
55 Ga0307516_10001719 3300031730 Bacteria 30077
56 Ga0307405_10010773 3300031731 Bacteria 4756
57 Ga0307413_10043352 3300031824 Bacteria 2651
58 Ga0307406_10003471 3300031901 Bacteria 8574
59 Ga0307412_10007078 3300031911 Bacteria 6365
60 Ga0307412_10039070 3300031911 Bacteria 3061
61 Ga0307409_100179247 3300031995 Bacteria 1874
62 Ga0307416_100004558 3300032002 Bacteria 8374
63 Ga0307414_10004721 3300032004 Bacteria 7436
64 Ga0307414_10033157 3300032004 Bacteria 3410
65 Ga0307510_10000061 3300033180 Bacteria 82810
66 Ga0373941_0076913 3300035115 Bacteria 1120
67 Ga0395900_0051656 3300037418 Bacteria 4234
68 Ga0395900_0188844 3300037418 Bacteria 2091
69 Ga0395905_0014713 3300037471 Bacteria 7462
70 Ga0395905_0073226 3300037471 Bacteria 3211
71 Ga0395905_0306158 3300037471 Bacteria 1477
72 Ga0395901_0554769 3300038443 Bacteria 1164
73 Ga0237819_00508 3300038705 Bacteria 13114
74 Ga0400483_086939 3300039062 Bacteria 1185
75 Ga0400483_240626 3300039062 Bacteria 1072
76 Ga0436361_0902848 3300039447 Bacteria 8157
77 Ga0436361_0909402 3300039447 Bacteria 1944
78 Ga0466968_0041934 3300044735 Bacteria 1933
79 Ga0466968_0101346 3300044735 Bacteria 1285
80 Ga0466968_0118231 3300044735 Bacteria 1197
81 Ga0495617_003311 3300046452 Bacteria 6097
82 Ga0495627_031161 3300046453 Bacteria 1686
83 Ga0495638_0001385 3300046460 Bacteria 22107
84 Ga0495638_0003575 3300046460 Bacteria 12174
85 Ga0495605_0000743 3300046474 Bacteria 23930
86 Ga0495584_0000459 3300046491 Bacteria 28080
87 Ga0495584_0012496 3300046491 Bacteria 4333
88 Ga0495594_0080017 3300046499 Bacteria 1824
89 Ga0495596_0000094 3300046500 Bacteria 62938
90 Ga0495607_0007593 3300046501 Bacteria 7479
91 Ga0495607_0016238 3300046501 Bacteria 4808
92 Ga0495606_0000078 3300046507 Bacteria 164950
93 Ga0495606_0001323 3300046507 Bacteria 33827
94 Ga0495606_0003386 3300046507 Bacteria 16957
95 Ga0495606_0020327 3300046507 Bacteria 4899
96 Ga0495610_0003832 3300046512 Bacteria 11456
97 Ga0495616_0000753 3300046513 Bacteria 23674
98 Ga0495616_0001634 3300046513 Bacteria 15368
99 Ga0495616_0029074 3300046513 Bacteria 2921
100 Ga0495620_0013168 3300046515 Bacteria 4244
101 Ga0495630_0037134 3300046517 Bacteria 3642
102 Ga0495632_0000017 3300046519 Bacteria 228941
103 Ga0495632_0002399 3300046519 Bacteria 14292
104 Ga0495632_0011697 3300046519 Bacteria 5108
105 Ga0495637_0027112 3300046520 Bacteria 2566
106 Ga0495643_0001774 3300046522 Bacteria 18560
107 Ga0495643_0003688 3300046522 Bacteria 11102
108 Ga0495643_0018351 3300046522 Bacteria 4068
109 Ga0495644_0003057 3300046523 Bacteria 6622
110 Ga0495648_0008373 3300046524 Bacteria 8149
111 Ga0495648_0104203 3300046524 Bacteria 1558
112 Ga0495654_0003511 3300046530 Bacteria 9574
113 Ga0495621_0000354 3300046539 Bacteria 11165
114 Ga0495622_0000475 3300046557 Bacteria 25362
115 Ga0495656_0163110 3300046615 Bacteria 1084
116 Ga0495661_0000231 3300046665 Bacteria 64275
117 Ga0495661_0000498 3300046665 Bacteria 40908
118 Ga0495671_0010580 3300046692 Bacteria 5101
119 Ga0495671_0022458 3300046692 Bacteria 3306
120 Ga0495649_0002592 3300046694 Bacteria 12636
121 Ga0495660_0060522 3300046810 Bacteria 2034
122 Ga0495672_0000391 3300047320 Bacteria 53759
123 Ga0495672_0000750 3300047320 Bacteria 35506
124 Ga0495683_0011038 3300047323 Bacteria 4764
125 Ga0495687_000190 3300047443 Bacteria 89269
126 Ga0495677_0014551 3300047445 Bacteria 2863
127 Ga0495673_0000406 3300047469 Bacteria 50318
128 Ga0495681_0011723 3300047470 Bacteria 5198
129 Ga0495681_0011965 3300047470 Bacteria 5125
130 Ga0495681_0078165 3300047470 Bacteria 1483
131 Ga0495626_0010410 3300048091 Bacteria 4962
132 Ga0496102_0221765 3300048905 Bacteria 1782
133 Ga0496104_0002415 3300048907 Bacteria 16088
134 Ga0496104_0019416 3300048907 Bacteria 6218
135 Ga0496105_0240990 3300048908 Bacteria 1467
136 Ga0496107_0080801 3300048910 Bacteria 2371
137 Ga0496112_0213768 3300048915 Bacteria 1885
138 Ga0496114_0026104 3300048917 Bacteria 4780
139 Ga0496115_0003484 3300048918 Bacteria 11313
140 Ga0496121_0000775 3300048924 Bacteria 58524
141 Ga0496124_0249447 3300048927 Bacteria 1314
142 Ga0496124_0413739 3300048927 Bacteria 932
143 Ga0496125_0010154 3300048928 Bacteria 9543
144 Ga0496125_0102282 3300048928 Bacteria 2106
145 Ga0496126_0002123 3300048929 Bacteria 27689
146 Ga0496126_0182155 3300048929 Bacteria 1784
147 Ga0495678_008830 3300049459 Bacteria 5039
148 Ga0495682_0000184 3300049460 Bacteria 51305
149 Ga0501031_0233865 3300049568 Bacteria 1195
150 Ga0501032_0046624 3300049569 Bacteria 2929
151 Ga0501036_0191183 3300049572 Bacteria 1722
152 Ga0501036_0256434 3300049572 Bacteria 1465
153 Ga0501038_0043785 3300049574 Bacteria 3891
154 Ga0501039_0338515 3300049575 Bacteria 1182
155 Ga0501043_0008245 3300049579 Bacteria 8209
156 Ga0501047_0000560 3300049581 Bacteria 39989
157 Ga0501047_0015958 3300049581 Bacteria 7162
158 Ga0501047_0267483 3300049581 Bacteria 1556
159 Ga0501068_0184030 3300049584 Bacteria 1322
160 Ga0501035_0066180 3300049822 Bacteria 3208
161 Ga0501044_0117735 3300049823 Bacteria 2660
162 Ga0501044_0154306 3300049823 Bacteria 2276
163 Ga0500643_000030 3300053087 Bacteria 206784
164 Ga0500643_000153 3300053087 Bacteria 69793
165 Ga0500643_000494 3300053087 Bacteria 28505
166 Ga0500643_006285 3300053087 Bacteria 4984
167 Ga0500643_008346 3300053087 Bacteria 4074
168 Ga0500643_008446 3300053087 Bacteria 4043
169 Ga0500643_022787 3300053087 Bacteria 2010
170 Ga0500594_0004356 3300053118 Bacteria 3117
171 Ga0500622_0004395 3300053156 Bacteria 8880

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0413739 Ga0496124_0413739_144_920 244
2 3300049569 Ga0501032_0046624 Ga0501032_0046624_2132_2908 244
3 3300049823 Ga0501044_0117735 Ga0501044_0117735_1846_2622 244
4 3300053087 Ga0500643_006285 Ga0500643_006285_12_788 244
5 3300025904 Ga0207647_10008002 Ga0207647_100080026 251
6 3300009093 Ga0105240_10004073 Ga0105240_100040735 276
7 3300009093 Ga0105240_10019395 Ga0105240_100193955 276
8 3300009553 Ga0105249_10023365 Ga0105249_100233652 276
9 3300010375 Ga0105239_10002865 Ga0105239_100028655 276
10 3300038705 Ga0237819_00508 Ga0237819_00508_9790_10662 276
11 3300046501 Ga0495607_0016238 Ga0495607_0016238_32_901 276
12 3300046522 Ga0495643_0018351 Ga0495643_0018351_345_1217 276
13 3300046524 Ga0495648_0104203 Ga0495648_0104203_632_1504 276
14 3300046692 Ga0495671_0010580 Ga0495671_0010580_3497_4369 276
15 3300047470 Ga0495681_0078165 Ga0495681_0078165_436_1308 276
16 3300053087 Ga0500643_022787 Ga0500643_022787_150_1022 276
17 3300053118 Ga0500594_0004356 Ga0500594_0004356_2012_2884 276
18 3300039062 Ga0400483_086939 Ga0400483_086939_76_951 277
19 3300039062 Ga0400483_240626 Ga0400483_240626_36_911 277
20 3300048929 Ga0496126_0182155 Ga0496126_0182155_875_1759 277
21 3300005340 Ga0070689_100170410 Ga0070689_1001704102 288
22 iso_pu_bacteria 2830075706 2830079365 290
23 iso_pu_bacteria 2880518877 2880521217 290
24 3300003771 Ga0055526_1000009 Ga0055526_1000009132 294
25 3300003794 Ga0055531_10044911 Ga0055531_100449111 294
26 3300005327 Ga0070658_10377241 Ga0070658_103772412 294
27 3300005548 Ga0070665_100000024 Ga0070665_100000024195 294
28 3300005548 Ga0070665_100081233 Ga0070665_1000812333 294
29 3300005844 Ga0068862_100001592 Ga0068862_10000159215 294
30 3300025295 Ga0209564_1000069 Ga0209564_100006982 294
31 3300025304 Ga0209257_1007906 Ga0209257_10079066 294
32 3300025304 Ga0209257_1010719 Ga0209257_10107193 294
33 3300025913 Ga0207695_10002449 Ga0207695_1000244924 294
34 3300025913 Ga0207695_10176351 Ga0207695_101763513 294
35 3300028379 Ga0268266_10000019 Ga0268266_10000019169 294
36 3300028379 Ga0268266_10003820 Ga0268266_100038208 294
37 3300028380 Ga0268265_10084335 Ga0268265_100843352 294
38 3300031730 Ga0307516_10001719 Ga0307516_1000171928 294
39 3300032004 Ga0307414_10033157 Ga0307414_100331572 294
40 3300033180 Ga0307510_10000061 Ga0307510_100000612 294
41 3300037471 Ga0395905_0014713 Ga0395905_0014713_2027_2953 294
42 3300039447 Ga0436361_0909402 Ga0436361_0909402_929_1855 294
43 3300044735 Ga0466968_0101346 Ga0466968_0101346_85_1011 294
44 3300044735 Ga0466968_0118231 Ga0466968_0118231_107_1033 294
45 3300046491 Ga0495584_0000459 Ga0495584_0000459_9785_10711 294
46 3300046500 Ga0495596_0000094 Ga0495596_0000094_17213_18139 294
47 3300046507 Ga0495606_0000078 Ga0495606_0000078_64344_65270 294
48 3300046507 Ga0495606_0001323 Ga0495606_0001323_3175_4101 294
49 3300046507 Ga0495606_0003386 Ga0495606_0003386_4294_5220 294
50 3300046507 Ga0495606_0020327 Ga0495606_0020327_886_1812 294
51 3300046519 Ga0495632_0000017 Ga0495632_0000017_219801_220754 294
52 3300046522 Ga0495643_0001774 Ga0495643_0001774_972_1898 294
53 3300047320 Ga0495672_0000391 Ga0495672_0000391_14677_15603 294
54 3300047443 Ga0495687_000190 Ga0495687_000190_58455_59381 294
55 3300048924 Ga0496121_0000775 Ga0496121_0000775_8973_9899 294
56 3300048929 Ga0496126_0002123 Ga0496126_0002123_8960_9886 294
57 3300049572 Ga0501036_0191183 Ga0501036_0191183_767_1693 294
58 3300049579 Ga0501043_0008245 Ga0501043_0008245_5735_6661 294
59 3300049581 Ga0501047_0000560 Ga0501047_0000560_9384_10310 294
60 3300049581 Ga0501047_0267483 Ga0501047_0267483_512_1438 294
61 3300049822 Ga0501035_0066180 Ga0501035_0066180_2001_2927 294
62 3300053087 Ga0500643_000030 Ga0500643_000030_91710_92636 294
63 3300053087 Ga0500643_000153 Ga0500643_000153_67994_68920 294
64 3300053087 Ga0500643_000494 Ga0500643_000494_26138_27064 294
65 3300053087 Ga0500643_008346 Ga0500643_008346_2374_3300 294
66 3300053156 Ga0500622_0004395 Ga0500622_0004395_7320_8246 294
67 3300003214 JGI25165J46597_1002053 JGI25165J46597_10020535 295
68 3300009093 Ga0105240_10010881 Ga0105240_100108812 295
69 3300025261 Ga0209233_1000034 Ga0209233_1000034182 295
70 3300025297 Ga0209758_1000485 Ga0209758_100048541 295
71 3300025913 Ga0207695_10008639 Ga0207695_100086392 295
72 3300031730 Ga0307516_10000124 Ga0307516_1000012475 295
73 3300037418 Ga0395900_0188844 Ga0395900_0188844_896_1825 295
74 3300037471 Ga0395905_0073226 Ga0395905_0073226_162_1091 295
75 3300038443 Ga0395901_0554769 Ga0395901_0554769_20_949 295
76 3300053087 Ga0500643_008446 Ga0500643_008446_2533_3462 295
77 iso_pu_bacteria 2995392953 2995394445 295
78 3300003775 Ga0055524_1000404 Ga0055524_100040430 296
79 3300006058 Ga0075432_10022686 Ga0075432_100226862 296
80 3300014497 Ga0182008_10017412 Ga0182008_100174123 296
81 3300015262 Ga0182007_10002819 Ga0182007_100028198 296
82 3300025949 Ga0207667_10000393 Ga0207667_100003939 296
83 3300037471 Ga0395905_0306158 Ga0395905_0306158_434_1363 296
84 3300044735 Ga0466968_0041934 Ga0466968_0041934_516_1445 296
85 3300046452 Ga0495617_003311 Ga0495617_003311_5091_6020 296
86 3300046453 Ga0495627_031161 Ga0495627_031161_739_1668 296
87 3300046460 Ga0495638_0001385 Ga0495638_0001385_10033_10962 296
88 3300046474 Ga0495605_0000743 Ga0495605_0000743_2933_3862 296
89 3300046491 Ga0495584_0012496 Ga0495584_0012496_3255_4184 296
90 3300046499 Ga0495594_0080017 Ga0495594_0080017_824_1753 296
91 3300046501 Ga0495607_0007593 Ga0495607_0007593_2008_2937 296
92 3300046512 Ga0495610_0003832 Ga0495610_0003832_6281_7210 296
93 3300046513 Ga0495616_0029074 Ga0495616_0029074_1164_2093 296
94 3300046515 Ga0495620_0013168 Ga0495620_0013168_907_1836 296
95 3300046517 Ga0495630_0037134 Ga0495630_0037134_883_1812 296
96 3300046519 Ga0495632_0011697 Ga0495632_0011697_552_1481 296
97 3300046520 Ga0495637_0027112 Ga0495637_0027112_490_1419 296
98 3300046523 Ga0495644_0003057 Ga0495644_0003057_1249_2181 296
99 3300046524 Ga0495648_0008373 Ga0495648_0008373_7071_8000 296
100 3300046530 Ga0495654_0003511 Ga0495654_0003511_3603_4532 296
101 3300046539 Ga0495621_0000354 Ga0495621_0000354_9399_10331 296
102 3300046557 Ga0495622_0000475 Ga0495622_0000475_11656_12585 296
103 3300046615 Ga0495656_0163110 Ga0495656_0163110_122_1054 296
104 3300046665 Ga0495661_0000231 Ga0495661_0000231_31100_32029 296
105 3300046692 Ga0495671_0022458 Ga0495671_0022458_2065_2994 296
106 3300046694 Ga0495649_0002592 Ga0495649_0002592_10439_11368 296
107 3300046810 Ga0495660_0060522 Ga0495660_0060522_348_1277 296
108 3300047320 Ga0495672_0000750 Ga0495672_0000750_4233_5162 296
109 3300047323 Ga0495683_0011038 Ga0495683_0011038_2690_3619 296
110 3300047469 Ga0495673_0000406 Ga0495673_0000406_32370_33299 296
111 3300047470 Ga0495681_0011723 Ga0495681_0011723_3791_4723 296
112 3300047470 Ga0495681_0011965 Ga0495681_0011965_1715_2644 296
113 3300049459 Ga0495678_008830 Ga0495678_008830_3589_4518 296
114 3300049460 Ga0495682_0000184 Ga0495682_0000184_32752_33681 296
115 3300049581 Ga0501047_0015958 Ga0501047_0015958_3048_3980 296
116 3300031731 Ga0307405_10010773 Ga0307405_100107734 297
117 3300031911 Ga0307412_10039070 Ga0307412_100390703 297
118 3300046460 Ga0495638_0003575 Ga0495638_0003575_2881_3813 297
119 3300048927 Ga0496124_0249447 Ga0496124_0249447_286_1236 297
120 3300005329 Ga0070683_100294805 Ga0070683_1002948052 298
121 3300005444 Ga0070694_100250134 Ga0070694_1002501341 298
122 3300005458 Ga0070681_10000898 Ga0070681_1000089824 298
123 3300007076 Ga0075435_100422151 Ga0075435_1004221511 298
124 3300021361 Ga0213872_10011556 Ga0213872_100115564 298
125 3300025916 Ga0207663_10053042 Ga0207663_100530423 298
126 3300039447 Ga0436361_0902848 Ga0436361_0902848_2174_3109 298
127 3300048907 Ga0496104_0019416 Ga0496104_0019416_3998_4942 298
128 3300048908 Ga0496105_0240990 Ga0496105_0240990_429_1373 298
129 3300048910 Ga0496107_0080801 Ga0496107_0080801_79_1026 298
130 3300048917 Ga0496114_0026104 Ga0496114_0026104_1641_2585 298
131 3300048918 Ga0496115_0003484 Ga0496115_0003484_1110_2054 298
132 3300048928 Ga0496125_0010154 Ga0496125_0010154_1667_2602 298
133 3300005339 Ga0070660_100032030 Ga0070660_1000320303 299
134 3300005539 Ga0068853_100061113 Ga0068853_1000611132 299
135 3300005548 Ga0070665_100003920 Ga0070665_10000392013 299
136 3300005548 Ga0070665_100217029 Ga0070665_1002170292 299
137 3300005937 Ga0081455_10001669 Ga0081455_100016698 299
138 3300006048 Ga0075363_100020492 Ga0075363_1000204922 299
139 3300006051 Ga0075364_10021987 Ga0075364_100219873 299
140 3300009545 Ga0105237_10085309 Ga0105237_100853092 299
141 3300009551 Ga0105238_10005328 Ga0105238_1000532811 299
142 3300025924 Ga0207694_10011281 Ga0207694_100112814 299
143 3300026041 Ga0207639_10023731 Ga0207639_100237312 299
144 3300031665 Ga0316575_10028386 Ga0316575_100283863 299
145 3300037418 Ga0395900_0051656 Ga0395900_0051656_512_1450 299
146 3300048905 Ga0496102_0221765 Ga0496102_0221765_25_963 299
147 3300048907 Ga0496104_0002415 Ga0496104_0002415_11753_12691 299
148 3300048915 Ga0496112_0213768 Ga0496112_0213768_276_1214 299
149 3300049568 Ga0501031_0233865 Ga0501031_0233865_185_1129 301
150 3300049572 Ga0501036_0256434 Ga0501036_0256434_12_956 301
151 3300049574 Ga0501038_0043785 Ga0501038_0043785_1246_2190 301
152 3300049575 Ga0501039_0338515 Ga0501039_0338515_81_1025 301
153 3300049584 Ga0501068_0184030 Ga0501068_0184030_283_1227 301
154 3300049823 Ga0501044_0154306 Ga0501044_0154306_284_1228 301
155 3300046513 Ga0495616_0000753 Ga0495616_0000753_18394_19341 302
156 3300046513 Ga0495616_0001634 Ga0495616_0001634_7479_8426 302
157 3300046519 Ga0495632_0002399 Ga0495632_0002399_6576_7523 302
158 3300046522 Ga0495643_0003688 Ga0495643_0003688_1978_2925 302
159 3300046665 Ga0495661_0000498 Ga0495661_0000498_34609_35556 302
160 3300047445 Ga0495677_0014551 Ga0495677_0014551_66_1013 302
161 3300048091 Ga0495626_0010410 Ga0495626_0010410_3810_4757 302
162 3300031824 Ga0307413_10043352 Ga0307413_100433522 303
163 3300031901 Ga0307406_10003471 Ga0307406_100034717 303
164 3300031911 Ga0307412_10007078 Ga0307412_100070785 303
165 3300031995 Ga0307409_100179247 Ga0307409_1001792472 303
166 3300032002 Ga0307416_100004558 Ga0307416_1000045587 303
167 3300032004 Ga0307414_10004721 Ga0307414_100047214 303
168 3300026116 Ga0207674_10112161 Ga0207674_101121614 304
169 3300013105 Ga0157369_10201498 Ga0157369_102014982 306
170 3300048928 Ga0496125_0102282 Ga0496125_0102282_890_1849 306
171 3300009093 Ga0105240_10000121 Ga0105240_10000121137 310
172 3300001989 JGI24739J22299_10048506 JGI24739J22299_100485062 312
173 3300035115 Ga0373941_0076913 Ga0373941_0076913_96_1091 318
174 3300001979 JGI24740J21852_10007835 JGI24740J21852_100078354 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05853

BKACE

beta-keto acid cleavage enzyme

44

328

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e49-assembly1.cif.gz_D crystal structure of a prokaryotic domain of unknown function (duf849) with a tim barrel fold (bxe_c0966) from burkholderia xenovorans lb400 at 1.75 a resolution 0.9185 40 332
3e02-assembly1.cif.gz_A crystal structure of a duf849 family protein (bxe_c0271) from burkholderia xenovorans lb400 at 1.90 a resolution 0.9179 39 332
3lot-assembly1.cif.gz_C crystal structure of protein of unknown function (np_070038.1) from archaeoglobus fulgidus at 1.89 a resolution 0.9112 40 332
3e49-assembly1.cif.gz_D crystal structure of a prokaryotic domain of unknown function (duf849) with a tim barrel fold (bxe_c0966) from burkholderia xenovorans lb400 at 1.75 a resolution 0.8749 40 332
3e02-assembly1.cif.gz_A crystal structure of a duf849 family protein (bxe_c0271) from burkholderia xenovorans lb400 at 1.90 a resolution 0.869 39 332
ID Description Score Start End Superfamily
3e49C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8975 40 332 3.20.20.70
3e49C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.877 40 332 3.20.20.70
af_P71976_1_271_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.865 41 326 3.20.20.70
af_P71976_1_271_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8558 41 326 3.20.20.70
2y7dC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8543 41 325 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2E7NU08-F1-model_v4 deleted 0.9749 187 332
AF-A0A529P1D9-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 0.9731 41 121 GO:0043720
GO:0046872
AF-A0A5N7YK83-F1-model_v4 deleted 0.9724 170 332
AF-A0A7C9RF70-F1-model_v4 3-keto-5-aminohexanoate cleavage protein 0.9711 41 115 GO:0043720
GO:0046872
AF-A0A7X6H8N2-F1-model_v4 deleted 0.9701 174 326

Feature Viewer

pLDDT pTM Quality
76.34 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map